KEGG   Sorghum bicolor (sorghum): 8080216Help
Entry
8080216           CDS       T01086                                 

Definition
(RefSeq) non-specific phospholipase C1
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00562  Inositol phosphate metabolism
sbi00564  Glycerophospholipid metabolism
sbi00565  Ether lipid metabolism
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8080216
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8080216
   00565 Ether lipid metabolism
    8080216
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sbi02042]
    8080216
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     8080216
Bacterial toxins [BR:sbi02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   8080216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 8080216
NCBI-ProteinID: XP_002466168
UniProt: C5WU42
Position
1
AA seq 542 aa AA seqDB search
MVAAARRDPGTRLLVALLLLALVVSGHCLDAHHRGLKRRRRKHEIHSPVKTVVVVVMENR
SFDHILGWLSRTRPDIDGLTGRESNRLNASDPSSPEIFVTDEAGYVDSDPGHGFEDIREQ
IFGSADTSAVPPPMSGFAQNARGMGLGMPQNVMSGFKPDAVPVYASLADEFAVFDRWFAS
VPTSTQPNRLFVHSATSHGLTFNARKDLIHGFPQKTIFDSLEENGLSFGIYYQNIPATLF
YQSLRRLKHLVKFHQYSLKFKLHAKLGKLPNYVVIEQRYFDCEMFPANDDHPSHDVARGQ
RFVKEVYETLRASPQWNETALIITYDEHGGFYDHVPTPVVGVPQPDGIVGPDPYYFKFER
LGVRVPTFLISPWIEKGTVIHAPNGPQETSQYEHSSIPATVKKLFNLHSNFLTKRDAWAG
TFENYLKIRKTPRTDCPEKLPEVTKSLRPFGPKEDSSLSEFQVELIQLASQLNGDHVLNT
YPDIGRTMTVGKANRYAEDAVARFLEAGRIALRAGANESALVTMRPALTSRASLSSGLSS
EL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgcggcccgccgcgaccccgggacgcgcctcctggtggcgctcctgctgctg
gcgctggtcgtctccgggcactgcctggacgcgcaccaccgcgggctgaagcgccggcgg
cgaaagcacgagatccactccccggtcaagacggtggtggtggtggttatggagaaccgc
agcttcgaccacatcctcggctggctcagccgcacccgccccgacatcgacggcctcacg
ggccgcgagtccaaccgcctcaacgcctccgacccctcctccccggagatcttcgtcacc
gacgaggccggctacgtcgactccgaccccggccacggcttcgaggacatccgggagcag
atcttcggctccgccgacacctccgcggtgccgccccccatgtccggcttcgcccagaac
gcgcgcggcatgggcctcggcatgccgcagaacgtcatgagcgggttcaagcccgacgcc
gtccccgtctacgcctccctcgccgacgagttcgccgtgttcgaccgctggttcgcctcc
gtgcccacctccacgcagcccaaccgcctgttcgtccactcggcgacatcccatggcctc
accttcaacgcccgcaaggacctcatccatggcttcccgcagaagaccatctttgacagc
ctcgaggagaacggcttgtcttttggcatctactaccagaacatcccggccacgctcttc
taccagagcctccgccgcctaaagcacctcgtcaagttccaccagtacagccttaaattc
aagctgcacgccaagttggggaagctgccaaattatgtggtgattgagcagaggtacttt
gattgcgagatgttcccagcaaacgatgatcatccgtcacatgatgtggcaaggggacag
aggttcgtgaaagaggtgtatgagacactgagggccagtcctcagtggaacgagacggcc
ctgattatcacatacgatgagcatggcggattctacgaccatgtccctacaccggttgtc
ggagtgccccaacctgatggaatagttgggcctgatccatactacttcaagttcgaacgg
cttggggtgcgtgttcccacctttctcatctcaccttggatcgagaagggcactgtgatt
catgcaccgaatggtccacaggaaacctcgcaatatgagcattcatccattcctgcaaca
gtaaagaagctattcaatttacattctaactttctgacaaagagagacgcatgggctggg
acctttgagaactaccttaaaatccggaaaacaccaagaactgactgtccagagaagctg
cccgaggtgacaaagtcactgcgaccatttggtcccaaggaagattcatctctctcggaa
tttcaagtggagttgattcaacttgcctcacagcttaacggtgatcatgtactgaacacg
tacccagatattggcaggaccatgactgtcgggaaagctaaccgctatgcagaggatgct
gtcgccagattcctggaagctggtcggattgctttgagagctggtgcaaatgaatctgct
ttggtgacgatgaggcctgctctcaccagcagggcctcattgtcctctggtttatcatca
gagctctaa

DBGET integrated database retrieval system