KEGG   Sorghum bicolor (sorghum): 8080677Help
Entry
8080677           CDS       T01086                                 

Definition
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00330  Arginine and proline metabolism
sbi00360  Phenylalanine metabolism
sbi00380  Tryptophan metabolism
sbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    8080677
   00360 Phenylalanine metabolism
    8080677
   00380 Tryptophan metabolism
    8080677
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     8080677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 8080677
NCBI-ProteinID: XP_021309548
Position
2
AA seq 510 aa AA seqDB search
MVDLRLQVVATVLGMVALAAAAGGSSSSGKQSEFQEVTVDAIHQGFKNGSLTSTALVRFY
LDQIARLNPLLHAVIEVNPDALAQAARADAERSASRGRCAVGLHGIPVLLKDNIATRDRL
NTTAGSLALLGSVVRRDAGVVARLRRAGAVILGKANPSEWSNFRPVESGWSARGGQTLNP
YVLSATPCGSSAGPGVAAAANMAAVTLGSETDGSILCPSSFNSVVGIKPTVGLTSRSGVI
PITPLQDTIGPMCRTVSDAVHVLDVIVGYDELDAEATGAASKYIPHGGYTQFLRIHGLKG
KRIGVLDVFFQGYDDMQLAVYEKHLDTMRQQGAVVIKNLDITTNFTDLGEQEILLMAAEF
KLSINAYLSDLLYSPVRSLAQIIAFNKAHPVEERLKDFGQPDLIAAEKTNGIGTRERAAI
QRLKEISTNGLEKLMKEHQLDAIVAANSDASSVLAVGGYPGIAVPAGYDKQGVPFAICFG
GLRGYEPRLIEIGYAFEQATKVRRPPTYKS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggttgaccttcgtctccaggtcgtcgccaccgtcctgggcatggtggccctggcggcc
gctgccggcggcagcagctccagcggcaagcagtccgagttccaggaggtcaccgtggac
gccatccatcagggcttcaagaacggcagtctcacctcgacggcgctcgtccggttctac
ctggaccagatcgcccgcctcaacccgctactccacgccgtcatcgaggtgaacccggac
gcgctggcgcaggcggcgcgcgccgacgcggagcgctcggcctcccgcggccgctgcgcc
gtcggcctgcacggaatccccgtcctgctcaaggacaacatcgccacgcgcgacaggctc
aacaccacggccggctccctcgctctgctcggctccgtcgtcaggcgcgacgccggcgtg
gtggcacgcctccgccgcgccggcgccgtcatcctcggcaaggctaacccttccgagtgg
tccaacttccgccccgtcgagtccggctggagcgcccgcggcggccagacgctgaatcca
tacgttctgtccgcgacgccatgcgggtcgagcgccgggcctggcgttgccgcggcagcc
aacatggcagcggtgacactgggatccgagaccgacggctccatcctctgcccatcgtcg
ttcaactctgtggttggcatcaaaccaactgttgggttgacaagccggtccggtgtcatc
cccatcactcctcttcaagacactattggaccaatgtgtcgcacagtatccgatgccgtc
catgtgttggacgtcattgtcggctatgacgagcttgatgctgaagccaccggagcagca
tccaaatacatcccgcacgggggatacacgcagttcctgaggatccatggattgaagggc
aagaggatcggtgtcctcgacgtgttctttcaaggatacgatgacatgcaattggcggtt
tacgagaagcatctcgatacaatgaggcaacaaggcgctgtcgtgatcaagaatcttgac
attacaacaaatttcactgatctgggtgagcaagagattctgctcatggctgcagagttc
aagttaagcatcaatgcgtatttgtcggacctactgtactccccagtccgctcccttgca
cagatcatagccttcaacaaagcacatcctgtagaggagagactcaaagattttgggcag
ccagacctgattgccgcggagaaaaccaacggcattggcaccagggagagagctgccatc
cagcggctcaaggagatatccaccaacgggttggagaagctgatgaaggaacaccagctg
gatgcgatcgtggcggccaacagcgacgcctcctctgttctcgccgtcgggggctatccg
ggcatcgccgtgccggcagggtacgacaagcagggagtcccatttgcaatatgctttggt
gggctcaggggctacgaaccaaggttgattgagatcggttatgcgttcgagcaggctacc
aaagtcagaaggccaccaacttacaagagctag

DBGET integrated database retrieval system