KEGG   Sorghum bicolor (sorghum): 8080748Help
Entry
8080748           CDS       T01086                                 

Definition
(RefSeq) uncharacterized protein LOC8080748
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbi01001]
    8080748
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8080748
Protein kinases [BR:sbi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   8080748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Haspin_kinase APH ABC1 Seadorna_VP7 PIP49_C
Motif
Other DBs
NCBI-GeneID: 8080748
NCBI-ProteinID: XP_002465197
Position
1
AA seq 944 aa AA seqDB search
MELIQEADRSKWMVHSNHSIRCFTQGDIERMSNNYRTSLGRGAFGEVYEGVLEDGSMVAV
KRLIGSVKEQFAKELIIHREINHKNVVRLIGYCVEENVLVLVMEYIANGNLNDVLHDDSR
PIPLDIRLRIAIECAEALAYMHSHMYTQVIHGDIKPGNILLDSNFHAKLSDFGISRVVNT
DKTLYTNNVIGSIGYMDPLFSLDGRLTVKYDVYSFGAVLVELITRKKAVVENVNNVYAFS
NALTRGVRGVREMLDVDIARKNNMKVLEGVAKLAGECLRMDRDKRPGMIVVAERLRVLQK
SSYQDQGRQRVDLFSWAWKSIPAPAALVNIQANILPSDMCRQFSFAEMKSATNNFDNSLL
VGKGGSGRVYCGQINGRKTNVAIKCMYTDTVVNEFYTEIEMMSKHRHRNLVPLIGYCIEE
DAMILVYDYMASGSLHGHLHGEQKLPLSWKQRIEICIGAGHGLRYLHEQQIIYLNLKMKN
ILLDEEWVAKITDLSLSRTGTSVKTRVAGTHGYIDPEYLITGRPTEKSDVYSFGVVLLET
LSAQRPYYSIRQDEQGHSLSSWTLRCKEEGNLDQIVDPCLMGIINLWSLNKFVEIALKCV
ALKGIDRPSMGDVISDLEHALQWQESADASESSILPSRLCRQFWFAEMEAVTNYFDKSLL
IDSGSFDRVYHSQIDGVAITLVDVTHVYSVCAFHGLIEITSKLVHDHLVPLIGYCDEQEM
MLLVYEYVAGGNLSEHLYGTRKPPLNWIQRMEICVGVARGLCYLHGWQLTHGAVRTSNIL
LDEECLAKITNLALPPNLLDNQASKVHETDGYIDPEYLHTGVHTEKSDVYCFGLVLLEVL
FGRPVIKHQRLEEQIAWLLIRGVQQQTLDYLDQNVDPFLRGKINPQFLKKFFRTAAKCLA
EKGIHRPSMRDVMSDLQYAHFSLKLGWITDDSGCMSDDAMDEGR
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggaacttatccaagaagctgatagatctaaatggatggtgcacagtaatcatagcata
agatgttttacacaaggtgacatagaaagaatgagcaacaactatagaactagtctcgga
agaggtgccttcggagaagtatatgaaggtgttcttgaggatggaagcatggttgcagtg
aaaaggttgataggcagtgtgaaagaacagtttgctaaagagcttatcattcatcgtgaa
atcaaccacaagaatgttgtgaggctcattggttactgtgtagaggaaaatgtccttgtg
ctggtcatggagtatattgctaatggaaatctgaatgatgttcttcacgatgacagccgt
cctatcccattggatataagacttagaatcgccattgagtgtgcggaagctttggcatac
atgcattctcacatgtatactcaggttatccacggtgacatcaagcctggtaacatactc
ttagatagcaactttcatgcaaaattgtcagactttggaatatcaagagtggtcaacaca
gacaaaacattgtacacaaataatgtaattgggagcataggttacatggaccctttgttt
tctttggatggtcgtcttactgttaagtatgatgtttatagctttggagctgtccttgtt
gaactgatcactaggaaaaaggcagtagttgagaacgtcaacaatgtttacgcatttagt
aatgctcttacaaggggggtcagaggtgtgagagagatgttagatgttgacattgcaaga
aagaataacatgaaggttcttgaaggagtcgcaaagctagcaggtgaatgcctaaggatg
gacagggacaaacgtcctgggatgattgttgtggcggaacgtcttcgggtgctacagaaa
tcttcatatcaggatcagggacggcagcgagtagatctgttctcttgggcatggaagagc
attccagcacctgcagctttagtgaacatccaggctaatattctgccgtcagacatgtgc
cgccagttctcttttgcagagatgaagtctgcaacaaacaattttgataattcactcctt
gttggcaagggtggatctggtagagtttactgtggccagattaatggacgaaaaaccaat
gtggctatcaagtgtatgtacaccgacaccgtagttaatgaattttatactgagattgag
atgatgtcaaagcaccgacaccgtaatctagtgccactgattggttactgcattgaagag
gatgcgatgatactggtctacgactacatggctagcggaagtctgcatggccacctccat
ggggagcagaagctgccactttcctggaagcagcgcatagagatctgcattggtgcaggt
catggtctgcgctaccttcacgaacaacagatcatttatcttaacctgaagatgaaaaat
atcctgctggatgaggaatgggttgccaagattaccgatctttctctttcccggactggg
acatcagtcaagacacgtgtagctggaactcatggctacatcgatcctgagtaccttata
accggtaggcctactgagaaatcagacgtctattcatttggggttgtgttattggagacc
ctctctgctcagcgtccttattattcaattcgtcaagatgaacaagggcatagcttgtca
agttggacattgcgatgcaaggaggaggggaatcttgatcagattgttgacccttgcctg
atgggaataattaatctgtggtctcttaacaagttcgtcgaaattgctctcaaatgtgtt
gctcttaaaggcattgatcgtccgtcgatgggagatgtgatttcagacctggagcacgcc
cttcagtggcaggagagtgcagatgcaagcgaatcctcaattttgccatcacgtctgtgc
cgccagttctggtttgcagaaatggaggccgtgacaaactactttgataagtcactcctt
attgatagtggttcatttgatcgagtttaccatagccagattgatggggtggcaataacc
ttggtggatgttacacatgtgtacagtgtatgtgccttccatggcctgatagagattaca
tcgaagcttgtccatgatcatcttgtgccactgattggttattgcgatgagcaggagatg
atgctcctggtctatgagtacgtggctggtggaaatctaagtgagcacctttatgggacc
aggaaaccaccccttaactggattcagcgcatggagatctgcgttggtgttgctcgtggc
ctgtgctaccttcacggatggcagctcacccacggggcagtgaggacatcaaacatccta
ctggatgaggaatgtcttgctaagattaccaatctagcactgccgcccaatcttttggat
aaccaggcatccaaagtccatgaaactgatggttacatcgatccagaatacttgcacacc
ggtgtgcatactgagaaatcagatgtctattgttttggccttgtgctactcgaagtcctc
tttggtcgccctgttatcaagcaccaacgtcttgaggaacaaattgcgtggttgttaatc
cgaggagttcaacagcagacattggactaccttgatcagaatgttgacccattcctaagg
ggaaaaattaatccacagtttctgaagaaatttttccgtactgccgctaagtgccttgct
gagaaaggcattcaccgcccatcgatgcgagatgtaatgtcagacctgcagtatgcccat
ttctcccttaagttgggttggatcacagatgatagcggttgcatgtcagacgatgccatg
gatgaggggaggtga

DBGET integrated database retrieval system