KEGG   Sorghum bicolor (sorghum): 8081901Help
Entry
8081901           CDS       T01086                                 

Definition
(RefSeq) uncharacterized protein LOC8081901 isoform X2
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    8081901
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     8081901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-GeneID: 8081901
NCBI-ProteinID: XP_002465714
UniProt: C5WUS3
Position
1
AA seq 418 aa AA seqDB search
MGNKKKPKPSRNKKKPKTSADQALALDYVRAWAHPAPPPPEPSAADADDFLPILATRGGD
VLFELHSHSNHSDGFLSPSALVERAHRNGVKVLALTDHDTMAGIPEAVSAASKFGIRIIP
GVEISALYNPREVAGAGETVHILAYYGMCGPSRPDELDSMLLNIRDGRYLRAKNMLQKLT
TLKVPIKWEHVTKIAGDGVAPGRLHIARAMVEAGYVENIRQAFNKYLGDDGPAYARGSEP
FAETVVQLISRTGGISALAHPWSLKNPDAIIRSLKGAGLNCMEVYRSDGKVDGFSELAEK
YGLLKLGGSDFHGRGGKDESDVGTVKLAITTLCCFLKMARSIWSSAMKDILLKFAEEPSA
ANLGNMLKFGRLTNFSGFSPINNGIHVVDFCLSSWSSAMEDVELEEVRLKLAHYVAER
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaagaagaagccgaagccgagcaggaacaagaagaagcccaaaaccagcgcc
gaccaggctctggccctagactacgtccgcgcctgggcgcaccccgcgccgccgccacca
gaaccctcggcggccgacgccgacgacttcctgccgatcctggctacgcgcggcggcgac
gtgctgtttgagctccactcccactcaaaccacagcgacggattcctctccccttccgcg
ctcgtcgagcgcgcccatcgcaatggggtgaaagttctcgccctaacagatcatgacacc
atggctggcataccagaagctgtgtcagcagcttccaagtttggcattagaataattcct
ggtgttgaaatcagtgcactatataatccaagggaagttgctggtgctggtgagactgtt
catatccttgcatactatggtatgtgtggtccgtcaagacctgatgagttggacagcatg
ctattgaacattagagatgggcgatacttacgcgcaaagaacatgctgcaaaagctaact
acactgaaggtgccaataaagtgggagcatgtgactaaaattgctggtgacggagtggca
cctggccgattgcatatagcaagggctatggttgaagcgggttatgtagagaatataagg
caagcattcaacaaatacctcggtgatgatggccctgcatatgccagaggaagtgaacca
tttgctgagactgtcgtgcagttaattagtcgcactgggggtatttctgcacttgctcat
ccttggtcattgaagaacccagatgcaataatcaggtctttaaaaggtgctggtcttaat
tgtatggaggtctacagaagtgacggaaaagttgatggatttagtgaattagcagagaag
tatggacttctgaaacttggaggttcagatttccatggaagaggtggaaaagatgaatct
gacgttggaacggttaagctcgctattacaactttgtgctgctttttgaagatggctagg
tctatctggtcttctgctatgaaagacatcctgcttaagtttgcagaggaaccatctgct
gcaaatctaggaaacatgcttaagtttggacgacttaccaatttttctggtttttctcca
ataaacaatggtattcacgttgttgatttctgcttatcttcatggtcttctgctatggaa
gatgttgagcttgaagaggtaagattgaagcttgcccattatgtagcagaaagataa

DBGET integrated database retrieval system