KEGG   Sorghum bicolor (sorghum): 8081917Help
Entry
8081917           CDS       T01086                                 

Definition
(RefSeq) alcohol dehydrogenase-like 7
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00010  Glycolysis / Gluconeogenesis
sbi00071  Fatty acid degradation
sbi00350  Tyrosine metabolism
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
sbi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8081917
  09103 Lipid metabolism
   00071 Fatty acid degradation
    8081917
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    8081917
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     8081917
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     8081917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C PEP-CTERM UDPG_MGDP_dh_N TrkA_N malic AlaDh_PNT_C Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 8081917
NCBI-ProteinID: XP_021306522
Position
1
AA seq 381 aa AA seqDB search
MENHGPKPIRCKAAVCRAAGEPLAIEEIVVDPPKEHEVRIRIICTSLCHSDVTFWRMKDF
PGIFPRIFGHEAFGVVESVGEHVEEFAAGDAVVPTFLGQCSECVDCRSARSNMCSKYRFA
VRPGMPRDGTTRFSDAQGRPLHHFLGVSSFAEYTVVDVNHAVKVNPAMPPALACLLSCGA
STGVGAAWKLAKVEPGSSVAIFGLGAVGLAVAEGARICGASKIIGVDINPDKYELGKKFG
MTHFINPKELGEKPVYQAIVEMTDGGADYCFECIGLAALMNDAFQSSREGWGKTIILGVE
MHGAPLAVSSHEILRGKSVIGSMFGGVKPKQDIPILADKYLNKELELDKFITHEVGLNDI
NEAFDLLLQGKSVRCTIWMDR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccatggccccaaaccaatccgatgcaaagcggccgtgtgcagggccgccggc
gagccgctggccatcgaggagatcgtcgtggacccgcccaaggagcacgaggtcaggata
aggatcatctgcacgtcgctctgccacagcgacgtcacgttctggcgcatgaaggatttc
cctggcattttccccagaatatttggccacgaagccttcggggttgtggagagcgtcggc
gagcacgtggaggagttcgccgcgggcgacgccgtggtgccgacgttcctggggcagtgc
agcgagtgcgtggactgcaggtccgcgcggagcaacatgtgctccaagtaccggttcgcg
gtgcgcccggggatgccgcgcgacggcaccacccggttcagcgacgcccaggggcgcccg
ctccaccacttcctgggcgtgtccagcttcgccgagtacaccgtggtggacgtgaaccac
gccgtcaaggtcaaccccgccatgccgccggcgctcgcctgcctgctcagctgcggcgcc
tccactggtgtcggagccgcatggaagctggcgaaagttgagcctggatcttcggtcgct
atctttggcctcggcgctgtaggattggcggtagctgaaggagccaggatttgtggggcg
tcaaagataataggcgtggatataaaccctgataaatatgaacttggcaagaagttcggc
atgacacattttatcaatccaaaagaacttggcgagaaacctgtctaccaggcgatcgtc
gagatgactgacggtggcgcggactactgcttcgagtgcattggactggcagcgctgatg
aacgacgcatttcagagctcccgagaggggtggggcaagacgatcattcttggagtggaa
atgcacggcgcccctctcgctgtctcttctcatgagatcctccgcgggaagtctgtcatt
gggtccatgttcggaggggtgaagcctaagcaggacattcccattctcgcagacaagtac
ctgaacaaggagctggagcttgacaagttcataacccatgaagttggcctcaatgacatc
aatgaagcttttgacctgctgctccaagggaagagtgtcaggtgcaccatatggatggac
aggtga

DBGET integrated database retrieval system