KEGG   Sorghum bicolor (sorghum): 8082559Help
Entry
8082559           CDS       T01086                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 7
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00052  Galactose metabolism
sbi00500  Starch and sucrose metabolism
sbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    8082559
   00500 Starch and sucrose metabolism
    8082559
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     8082559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 8082559
NCBI-ProteinID: XP_002448713
Position
6
AA seq 625 aa AA seqDB search
MLIRDSSAEAELEQSNQRVRSRPASTMAGLPLSVVAFHLCLLASSSSSSALRPATTASES
DGGGSRAGRTAYHFQPAKNWQNDPNGPMYYNGMYHFFYQYNPHGALWDIGNLSWGHSVSG
DLVNWAALDTALDPTSPFDANGCWSGSATILPGGTPAILYTGIDASGEQVQNVAFPRNPA
DPLLREWDKPSYNPVIPLPADVPGDKFRDPSTAWLGRDGLWRIVVSAEVRGVASTLVYRS
PDFLRWERAATAPLHASRAAGMVECPDLFPVKEESGGDDDGEGLDASASGDGVRHVLKLS
VMDTLQDYYMVGRYDAAADAFVPAEPERGDDVRAWRRLDYGHVYASKSFFDARHSRRVLW
AWANESDSQADDVAKGWSGVQTFPRKLWLDEDGKQLRQWPVEEIETLRRKRVGLRRGTVL
SAGGMNEIVGVAGSQADVEVEFKVPSLAEAEALDANRLLDPQKLCGEKGASVPGGVGPFG
LIVLASGDLREHTTVFFRVFRHQGRYRLLMCTDLTRSTTRAGVYKPPYGGFVDVDVEEHE
TIKLRTLIDHSMLESFGAEGRICITARVYPEHAETSNSHLFVFNNGTGKVEVPKLEAWEL
AAATVNAVGDAGLIVSQSKDESESY
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgttaatccgggactcgtcagcagaggcagagctggagcagagcaaccagagggttcgc
tctcgtcccgcatcgaccatggcggggctcccgctgtccgtcgtcgccttccacctgtgc
ctcctcgcgtcgtcgtcgtcgtcgtctgctcttcggccggcgacaaccgcgagcgagagc
gacggcggcggcagccgtgccggcaggaccgcctaccacttccagcccgccaagaactgg
cagaacgatccgaatgggccgatgtactacaacggcatgtaccatttcttctaccagtac
aacccgcacggcgcgctctgggacatcggcaatctctcctggggccactccgtctccggc
gacctcgtcaactgggccgcactggacacggcgctggacccgacgtcgcccttcgacgcc
aacggctgctggtcgggctccgccaccatcctccccggcggcaccccggccatcctctac
acgggcatcgacgccagcggggagcaggtgcagaacgtggcgttcccgaggaaccctgcc
gaccctctcctccgcgagtgggacaagcccagctacaaccccgtcatcccgctccccgcc
gacgtccccggcgacaagttccgggacccctcgacggcgtggctgggccgcgacgggctg
tggcgcatcgtggtgtccgccgaggtccgcggcgtggcgtccacgctcgtgtaccggagc
ccggacttcctccgctgggagcgcgcggccaccgcgccgctgcacgcctcgcgcgccgcg
ggtatggtggagtgcccggacctgttcccggtgaaggaggagagcggtggcgacgacgac
ggtgaagggctcgacgcgtcggcgagcggcgatggggtgcggcacgtgttgaagctcagc
gtgatggacacgctccaggactactacatggtggggcggtacgacgccgcggcggacgcg
ttcgtgccggcggagcccgagcgcggcgacgacgtgcgcgcctggcggcggctggactac
ggccacgtgtacgcgtccaagtccttcttcgacgcgcgccacagccggcgcgtgctgtgg
gcgtgggccaacgagtccgacagccaggccgacgacgtcgccaagggctggtccggcgtt
cagacgttcccgaggaagctgtggctggacgaggacgggaagcagctgcggcagtggccg
gtggaggagatcgagacgctacggaggaagcgcgtcggcctgcgccgcggaacggtgctg
agcgccggaggcatgaacgagatcgtcggcgtcgccgggtcgcaggcggacgtggaggtc
gagttcaaggtcccgagcctggctgaggccgaggcgctggacgccaaccggctgctggac
ccgcagaagctgtgcggggagaagggcgcctcggtgccgggcggcgtcgggccgttcggg
ctcatcgtgttggcctccggcgacctgcgggagcacaccaccgtcttcttccgggtgttc
aggcaccagggcaggtacaggcttctcatgtgcaccgacctaacgaggtcgacgacgagg
gccggcgtgtacaagccgccatacggaggattcgtggacgtcgacgtagaggagcacgag
accatcaaattgagaaccctgattgatcactcgatgctggagagcttcggagctgaaggg
cggatctgcatcactgctcgagtgtaccctgagcacgcggagacgagcaacagccacttg
ttcgtgttcaacaatggcacgggcaaggtggaggtgcccaagctcgaggcatgggagctc
gccgcggcgaccgtgaatgctgttggggatgccggcctgatcgtgtctcaatctaaagac
gaaagtgaatcctattaa

DBGET integrated database retrieval system