KEGG   Sorghum bicolor (sorghum): 8084182Help
Entry
8084182           CDS       T01086                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IV.1
Organism
sbi  Sorghum bicolor (sorghum)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr APH Pkinase_fungal Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 8084182
NCBI-ProteinID: XP_002463819
UniProt: C5WZ73
Position
1
AA seq 644 aa AA seqDB search
MPLLALAVLLASLQHAASAGAGQFTYNGFAVASLAVDGAARVAPSGLLVLTNGTVAMTGH
ALHPSPLQFREPTSNGTGTVRSFSASFVFAIVGQYLHLSSHGLAFFVSRTRSLSTTMPFQ
YLGLLNTTDGAGAASNHILAVEFDTVLNYEFGDINNNHVGIDVDSLRSVAAERAGYYADA
DADGSVFRDLSLFSREAMQVWVDYDGRSTVLDVTLAPVGVPRPKKPLLSRAVDLAAVVPA
EAYVGFSSSTGVMACSHYVLGWSFALDGAAPPLDVSRLPDYPRPSSKPGRRRKVLAIVLP
IAAVAAAAVVTVAAVLVCVRRRMEYAELREDWEAEFGAHRFAYKDLHRATGGFADKRLIG
QGGSGEVYRGVLPRCNAEVAVKRVSDESRQGMKEFVAEVASMGRLRHRNLVPLLGYCRRK
GELLLVYMYMPNGSLEKLLYDQGSKVTLGWDQRFRIIKDIAAGLLYLHEEWEQVIVHRDI
KPSNVLLDDEMNGRLGDFGLARLYDHGASSYTTRVVGTTGYLAPELMRTGKANPATDVFA
FGAFLLEVACGRRPIEQGMEGEDFALVDHVLGHCLSGSLMEAVDSKLQDDYDAEEVCLAL
KLGLLCSHPLASERPSMRQVVQYLDGGAAFPELALTNLNAGKLM
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcctcgcgcttgccgtcctcctagccagcctgcagcacgcggcatccgccggc
gccggccagttcacctacaacggcttcgcggtcgcgagcctcgcggtcgacggcgccgcg
cgggtggcgcccagcggcctcctcgtgctcaccaacggcacggtggccatgacaggccac
gcgttgcacccgtccccgctccagttccgggagccgacgtccaacggcactggcacggtg
cggtccttctctgcgtcgttcgtgttcgccatcgtcgggcagtacctccacctgagcagc
cacgggctggccttcttcgtctcgcgcacccggagcctctccaccaccatgccgttccag
tacctgggcctcctcaacaccaccgacggcgccggggcggccagcaaccacatcctcgcg
gtcgagttcgacacggtgctcaactacgagttcggcgacatcaacaacaaccacgtcggc
atcgacgtcgacagcctccggtccgttgccgcggagagggctggctactacgccgacgcc
gacgccgacggctccgtgttccgcgacctgagcctcttcagccgcgaggcgatgcaggtg
tgggtggactacgacggccgctccacggtgctcgacgtgacgctggcgcccgtcggcgtg
cccaggcccaagaagcccctcctctcgcgcgccgtcgacctcgccgcggtggtgcccgcc
gaggcgtacgtcggcttctcgtcctcgaccggcgtcatggcgtgcagccactacgtgctc
ggctggagcttcgccttggacggcgccgcgccgccgcttgacgtctcccgactacccgac
tacccgcgccccagctcgaagcccggaagacgacggaaggtgctggccatcgtgcttccg
atagcggccgtcgcggcagccgcagtcgtcacggtcgccgccgtcctggtctgcgtgcgc
cggcggatggagtacgcggagctgcgcgaggactgggaggccgagttcggcgcgcaccgg
ttcgcgtacaaggacctgcaccgtgccaccggtggcttcgcggacaagagactgatcggg
caaggcggcagcggcgaggtgtaccgtggcgtgcttccacgatgcaacgcagaggtcgcc
gtgaagagggtgtcggacgagtcgaggcaaggcatgaaggagttcgtcgccgaggtcgcg
agcatgggccggctaaggcaccgcaacctcgtgccgctgcttggctattgccgccggaaa
ggggagctacttttggtgtacatgtacatgccaaacggtagcctcgagaagcttctatat
gaccaaggcagcaaggtgaccctaggttgggatcagaggtttcggatcatcaaagatatc
gcggcaggtctgctgtacctacacgaggagtgggaacaggtgatcgtgcaccgagacatc
aagccaagcaacgtgctcctcgacgacgagatgaacggccggctcggtgactttggcctc
gcaagattgtatgaccatggtgcgagctcttatacaactcgtgtggtcggcaccacgggg
tacctagctcctgagctaatgcgcacggggaaggcaaacccggcgacggatgttttcgcc
ttcggcgcattccttctagaggtggcatgtgggagaagacccattgagcagggcatggag
ggggaggattttgcactcgtggaccatgttcttggacactgtctcagtggatctctaatg
gaagcagtggactcaaagcttcaggatgactatgacgcggaggaggtgtgcctagctctg
aagcttggattactctgctcacaccctctggccagtgaaagaccgagcatgaggcaagtt
gtgcagtatctagatggtggggcagcgttcccagagctagcactgaccaatcttaacgcc
ggaaagttgatgtag

DBGET integrated database retrieval system