KEGG   Sorghum bicolor (sorghum): 8084227Help
Entry
8084227           CDS       T01086                                 

Definition
(RefSeq) 4-hydroxy-7-methoxy-3-oxo-3,4-dihydro-2H-1, 4-benzoxazin-2-yl glucoside beta-D-glucosidase 2, chloroplastic
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00460  Cyanoamino acid metabolism
sbi00500  Starch and sucrose metabolism
sbi00940  Phenylpropanoid biosynthesis
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    8084227
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    8084227
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    8084227
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     8084227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 8084227
NCBI-ProteinID: XP_021321658
Position
8
AA seq 416 aa AA seqDB search
MALLLASAMNHTAHPAELRSHLGRPNNESFSRHHLCSSPQNISKRRSNLSFRPRAQTISS
EPGIHMLSPWEIPRRDWFPPSFLFGAATASYQIEGAWNEDGKGPSTWDHFCHNFPEWIVD
RSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSISWPRILPKGTLAGGINEKGVEYYNKLI
DLLLENGMEPYITIFHWDAPQALVDTYGGFLDERIIKDYTDFAKVCFEKFGKKVKNWFTF
NEPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLTEPYIVAHNLLRAHAETVDLYNKYH
KGADGRIGLALNVFGRVPYTNTFLDQQAQEMSMDKCLGWFLEPVLRGDYPFSMRVSARDR
LPYFKEKEQEKLVGSYDMIGINYYTSTFSKHNDISANYSPVLNTDDAYASQKSKKL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctctacttcttgcttctgccatgaatcacactgctcatccagcagaacttagaagc
catctaggacgacccaataatgagagtttctcacggcaccacctttgttcttcaccacaa
aacatcagtaagcgaaggtctaaccttagctttaggccacgagctcaaacgataagcagt
gagcctggaatccacatgctgagcccctgggaaatccctaggagggactggttcccccct
agctttctcttcggtgctgccactgcatcataccaaattgaaggtgcttggaatgaagat
gggaaggggccaagcacatgggatcacttctgccacaattttccggaatggatagtggac
aggagcaatggggatgttgcagcggattcgtaccatatgtacgctgaggatgtcaggttg
ctgaaggaaatgggcatggacgcctataggttctccatctcttggcccagaatactgcca
aaggggacgctcgctggaggtattaacgagaaaggcgtcgagtactacaacaagttgatc
gacttgttgctagagaacggcatggagccatatataacaattttccactgggacgcgcct
caagcgctggtagacacgtatggcggcttcttagatgagaggattataaaagattacaca
gacttcgctaaagtgtgctttgaaaagtttggtaagaaggtgaaaaactggttcaccttt
aatgagccggagacattttgttctgtttcctatggaactggagtccttgcccctgggcgg
tgctcaccaggagtaagttgtgccgttccaactggaaactcactcaccgagccatacatt
gttgcccacaaccttctccgagctcatgctgagactgttgatctttacaacaagtatcac
aagggtgcggacggccgtatagggcttgctttaaatgtatttggtcgtgtgccatacaca
aatacgtttctcgatcaacaggcccaagaaatgtccatggacaaatgcctaggatggttc
ttggagccagtgcttcgtggtgactaccccttctccatgagagtgtcggcgagggatcgg
ctgccctacttcaaagaaaaagagcaagagaagctagttggttcttacgatatgatcggg
ataaactactacacctcaacgttctccaagcacaacgacatctcagcaaactactcgcca
gtgctcaacactgacgatgcctatgccagtcaaaaaagtaagaaattatag

DBGET integrated database retrieval system