KEGG   Sorghum bicolor (sorghum): 8084715Help
Entry
8084715           CDS       T01086                                 

Definition
(RefSeq) pyruvate decarboxylase 2
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00010  Glycolysis / Gluconeogenesis
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8084715
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     8084715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C Cys_rich_CWC
Motif
Other DBs
NCBI-GeneID: 8084715
NCBI-ProteinID: XP_002465414
UniProt: C5WNH9
Position
1
AA seq 610 aa AA seqDB search
MDTHVGSVNGSAAAPASNDTVGCPASAPGCPMASTPAQPASTLSAGEASLGRHLARRLVQ
VGVNDVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTV
GGLSVLNAIAGAYSENLPVICIAGGPNSNDYGTNRILHHTIGIPDFSQELRCFQTVTCHQ
AVVTNLDDAHEQIDTAIATALRESKPVYLSISCNLPALPHPTFSRDPVPFFLAPRMSNKM
GLEAAVEATVEFLNKAVKPVLVGGPKLRVAKAGKAFVDLVDASGYAYAVMPSAKGLVPET
HPHFIGTYWGAVSTAFCAEIVESADAYLFAGPIFNDYSSVGYSFLLKKDKAIIVQPERVI
IGNGPAFGCVMMKEYLSELAKRVKKNTTAYENYKRIFVPEGQPLESQPNEPLRVNVLFKH
IQKMLTGDSAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGALLGYAQGANQKR
VIACIGDGSFQVTAQDVSTMLRCEQNSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGFV
DAIHNGEGKCWTSKVKCEEELTAAIETALAEKKDCLCFIEVIAHKDDTSKELLEWGSRVS
AANSRPPNPQ
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggacacccacgtcggatccgtgaacggatcggcggcggcgccggcgtcgaacgacacg
gtgggctgcccggcgtcggcgccggggtgcccgatggcgtccacgccggcgcagcccgcg
tcgacgctgtcggcgggggaggcgtcgctggggcgccacctcgcgcggcgcctcgtgcag
gtcggcgtcaacgacgtcttcgcggtccccggggacttcaacctcacgctgctcgaccac
ctgatcgccgagcccgggctgcgcctcgtcggctgctgcaacgagctcaacgccgggtac
gccgccgacgggtacgcgcgcgcgcgcggcgtcggggcctgcgccgtcacgttcaccgtc
gggggcctcagcgtgctcaacgccatcgcgggcgcctacagcgagaacctgcccgtcatc
tgcatcgccggcgggcccaactccaacgactacgggaccaaccgcatcctccaccacacc
atcggcatccccgacttctcgcaggagctgcgctgcttccagaccgtcacctgccaccag
gcggtggtgaccaatctggacgacgcgcacgagcagatcgacacggcaattgccacggca
ctgagggagagcaagccggtgtacctcagcatcagctgcaacctccccgcgctgcctcac
cctacctttagccgcgaccccgtgcccttcttcctcgcccccaggatgagcaacaagatg
gggctagaggctgcagtggaagcaactgtcgaattcctgaacaaggcggtgaagccagtg
cttgttggcggccccaaactgcgtgtggcaaaggcaggaaaggcatttgtcgatctggta
gatgccagtggctatgcctatgcagtgatgccatcggccaagggtcttgtgccagagacg
cacccccacttcatcggcacctactggggcgccgtcagcactgccttctgtgctgagatt
gttgagtccgcagatgcctacctctttgcaggccccattttcaatgactacagctctgtt
ggctactcattcctcctcaagaaggacaaggccatcatcgtccagcctgaacgtgtgata
attggtaatgggccggcattcggatgtgtgatgatgaaggagtacttgtctgaattggct
aagagggttaagaagaacaccactgcctatgagaactacaagaggatctttgtacctgag
gggcagccgctggaaagccagccgaatgagccactgcgagtcaatgtgctcttcaagcac
atccagaagatgttgaccggtgatagtgctgtgattgctgagactggtgactcctggttc
aattgccagaagcttaagctgccagaaggctgtggatatgaattccaaatgcagtatggt
tcaattggatggtcagtgggtgcattgcttggctatgctcagggtgcaaaccaaaagcgt
gtgattgcctgcattggtgatgggagcttccaggttacagcacaggatgtgtcaaccatg
ctgcgatgtgaacagaacagcataatcttcctgatcaacaatggtgggtacacaattgag
gtggaaatccatgacggaccatacaacgtcatcaagaactggaactacactggctttgtg
gatgccatccacaatggagagggcaagtgctggacctccaaggtgaagtgcgaggaggag
ctgacggcagctattgagacggctctagcggagaagaaggactgcctgtgcttcatcgag
gtgatcgcgcacaaggacgacaccagcaaagagctgctggaatggggttccagggtttct
gctgccaactccaggccaccgaatcctcagtag

DBGET integrated database retrieval system