KEGG   Sorghum bicolor (sorghum): 8085037Help
Entry
8085037           CDS       T01086                                 

Definition
(RefSeq) polyamine oxidase
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00330  Arginine and proline metabolism
sbi00410  beta-Alanine metabolism
sbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    8085037
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    8085037
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     8085037
    1.5.3.16  spermine oxidase
     8085037
    1.5.3.-  
     8085037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Pyr_redox_3 GIDA FAD_binding_2 Thi4 FAD_oxidored NAD_binding_9 FAD_binding_3 Shikimate_DH Pyr_redox HI0933_like dCMP_cyt_deam_2
Motif
Other DBs
NCBI-GeneID: 8085037
NCBI-ProteinID: XP_002445199
UniProt: A0A1Z5R902
Position
7
AA seq 560 aa AA seqDB search
MLREYYTRTNTHTSTYTSHYIYVWVTLCAYIVRSASIYRGQCIHFKLLYRERSTSVREMS
SSTSSALVVVVAAVLLALTLAQHGSLAATVGPRVIVVGAGMSGISAAKRLSDAGITDLLI
LEATDHIGGRMHKKNFAGINVEVGANWVEGVNSNRGKMNPIWPIVNSTLKLRNFRSDFDY
LAQNVYKEDGGLYDEDYVQKRIDRADSVEELGEKLSGTLHASGRDDMSILAMQRLYDHQP
NGPATPVDMVVDYYKYDYEFAEPPRVTSLQNVVPLPTFSDFGDDVYFVADQRGYEAVVYY
LAGQFLKTDRSGKIVDPRLQLNKVVREINYSPGGVTVKTEDNSVYRADYVMVSASLGVLQ
SALIQFKPQLPAWKVTAIYQFDMAVYTKIFLKFPKKFWPEGKGREFFLYASSRRGYYGVW
QEFEKQYPGANVLLVTVTDEESRRIEQQSDNQTKAEIMQVLRKMFPGKDVPDATDILVPR
WWSDRFYKGTFSNWPIGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAE
ILINCAQKKMCKYHVQGKYD
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtgaatactacacacgcacaaacacacacactagtacgtatacatcacactac
atatatgtgtgggtgactctgtgtgcatatatagtgcgaagtgcgtcgatatataggggg
caatgcattcacttcaaactgctgtatagagagcgatcgacatcagttagagagatgagt
tcctccacgtccagcgctctcgtagtagtagtagcagcagtactcctagcactgacctta
gcacagcatggctccctcgccgcaaccgtcggccctagggtcatcgtcgtcggcgccggc
atgtctgggatctcggcggcgaagaggctgtcggacgccgggataaccgacctgctcatc
ctggaagcgacggaccacatcggcggccggatgcacaagaagaacttcgccggcatcaac
gtcgaggttggagccaactgggtggagggagtgaattcgaaccgcggcaagatgaacccg
atctggcccatcgtcaactccacgctcaagctccggaacttccgctccgactttgattac
ctcgcccaaaacgtctacaaggaggatggtggcctctacgatgaagattatgttcagaag
agaattgaccgagccgatagcgtggaagagctcggggagaagctgtctggcactttgcac
gccagtggcagggacgacatgtctatccttgcaatgcagcgcctctacgatcaccagccg
aacgggccggcgacgccggtggacatggtggtggactactacaagtacgactacgagttc
gcggagccgccgcgggtgaccagcctgcagaacgtcgtccctctgccgaccttcagcgac
ttcggcgacgacgtctacttcgtcgccgaccagcgtggttacgaggccgtcgtgtactac
ctcgccggccagttcctcaagaccgacaggtctgggaaaatcgtcgatccacggctccag
ctcaacaaggtggtgcgagaaatcaactattctccgggtggcgtcaccgtgaagacggag
gacaactcggtgtacagggcagactatgttatggtttctgcaagcctgggtgtcctgcaa
tccgctctcattcagttcaagccgcagctacctgcatggaaggttacggcgatctaccaa
ttcgacatggccgtgtacacaaagatattcctcaagttccccaagaagttctggcctgaa
gggaaagggagagagttcttcctctacgcgagcagcaggagaggttactatggtgtctgg
caggagtttgagaagcagtatcctggtgccaacgtcctcctcgttaccgtgaccgacgag
gagtcgaggcgtattgagcagcagtcggacaaccagaccaaggcagagatcatgcaagtg
ctgaggaagatgttccccggcaaggacgtcccggatgccaccgacatccttgtcccgaga
tggtggtctgacaggttctacaaaggcacattctccaattggccaattggtgtcaaccgc
tacgaatacgaccagcttagggcaccggttggcagggtatacttcaccggtgagcacacc
agcgagcactacaatggctatgtccatggcgcttatctttcaggtatcgactctgctgaa
attctcatcaactgcgcccagaaaaagatgtgcaagtaccatgtccagggcaagtatgac
tag

DBGET integrated database retrieval system