KEGG   Shewanella bicestrii: CF168_01630Help
Entry
CF168_01630       CDS       T05197                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
sbj  Shewanella bicestrii
Pathway
sbj00640  Propanoate metabolism
sbj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CF168_01630
Enzymes [BR:sbj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     CF168_01630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C TetR_C_3
Motif
Other DBs
NCBI-ProteinID: ASK71166
UniProt: A0A220UT89
Position
complement(344820..347423)
Genome map
AA seq 867 aa AA seqDB search
MTTAMNRLYRKPLPGTALDYFDTREAVEAISPGAYAKLPYTSRVLAENLVRRCEPEALTD
SLKQIIESKQELDFPWFPARVVCHDILGQTALVDLAGLRDAIAAKGGDPAQVNPVVPTQL
IVDHSLAVEYGGFDKDAFAKNRAIEDRRNEDRFHFINWTQKAFKNIDVIPQGNGIMHQIN
LERMSPVVHARDGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAESVMLGRASYMRLPD
IIGVELTGKPQPGITATDIVLALTEFLRKEKVVSSYLEFFGEGAEALTLGDRATISNMTP
EFGATAAMFYIDQQTLDYLTLTGRSDEQVKLVETYAKTTGLWSDDLKQAEYPRTLHFDLS
SVVRTIAGPSNPHARVPTSELAARGISGVVENEPGLMPDGAVIIAAITSCTNTSNPRNVI
AAGLLARNANAKGLSRKPWVKTSLAPGSKAVQLYLEEANLLPELESLGFGIVGFACTTCN
GMSGALDPVIQQEVIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIR
FDIEKDVLGHDKDGNPVRLIDIWPTDAEIDAVIAASVKPEQFRKVYEPMFDLSVDYGDKV
SPLYDWRPQSTYIRRPPYWEGALAGERTLKGMRPLAVLGDNITTDHLSPSNAIMMDSAAG
EYLHKMGLPEEDFNSYATHRGDHLTAQRATFANPKLKNEMAVVDGKVKQGSLARIEPEGQ
VTRMWEAIETYMDRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIIAEGFERIHRTNL
VGMGVLPLEFKAGENRATYGIDGTEVFDVYGEIAPRADLTVVISRKNGERVEVPVTCRLD
TAEEVSIYSAGGVLQRFAQDFLESNLK
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagctatgaatcgcctctatcgcaagcccttaccaggcacagcacttgactat
ttcgatacccgtgaagccgttgaagccatcagccccggcgcctacgctaaactgccctac
acctcacgtgtattagcagaaaacttagtgcgtcgctgcgagccagaagcactcacagac
tcactaaaacaaattattgaatcaaaacaggaactggattttccatggttccctgcgcgt
gtagtgtgccacgatattttagggcaaaccgcgctggtagacttagcgggtctgcgtgat
gcgattgccgctaagggtggcgatccggcgcaggttaaccctgtggttccgacccagctg
attgtcgaccattctctggcggtggaatatggtggtttcgataaggatgcctttgcgaaa
aaccgcgccatcgaagatagacgcaacgaagacagattccactttatcaactggactcaa
aaggcgtttaaaaacattgatgtcatcccgcagggcaacggcatcatgcaccagatcaac
ctggagcgtatgtcacccgtggtccatgcccgtgatggcgtggcgttccccgatacctta
gtgggcaccgacagccatacgccacacgtggatgcgctgggtgttatcgccatcggcgtg
ggcgggcttgaggccgaaagcgtgatgttaggccgcgcctcttatatgcgtctacccgac
attatcggtgttgagctcacaggcaagcctcaaccgggcattaccgccaccgatatcgta
ttagccttgaccgaattcctgcgtaaggaaaaagtagtttcttcttaccttgagttcttc
ggcgaaggcgcagaggctttaacacttggcgatcgcgcgactatctctaacatgacgcca
gaatttggcgccaccgccgccatgttctatatcgaccaacaaacgctggactacttaacc
ctgacgggtcgtagcgacgagcaagtgaagctggttgaaacctatgccaagaccacaggt
ttgtggagcgatgacctcaagcaggccgagtacccacgtaccctgcattttgacctgtca
tcggtagtgcgtaccattgctggcccatcgaatccccatgctcgcgttccgacttcagag
ttggccgcgcgcggcatcagcggcgtagttgaaaatgagccaggcttaatgccagatggc
gccgtgattattgcggccatcactagctgcaccaataccagtaacccacgcaacgtaatt
gcggcgggcctactggcacgtaacgccaatgccaaaggcttaagccgtaaaccttgggtg
aaaacctcactcgcccccggctctaaggcggtacaactgtatttagaagaagccaacttg
ctgccagagctggagtcattaggctttggtattgtcggttttgcctgcaccacctgtaac
ggtatgagcggcgcactcgacccggttattcagcaggaagtgatcgaccgcgatctttac
gccaccgccgtattatccggtaaccgtaacttcgacggccgtattcacccttacgctaag
caagccttcctcgcatcaccaccattagtcgtcgcctacgcaatcgcgggcaccattcgt
ttcgatatcgagaaggatgtgttaggccacgataaagatggcaacccagtgcgcttaatc
gatatttggccaacggatgccgaaatcgatgccgtgattgcagcaagcgtgaagccagag
cagttccgtaaggtctacgagccgatgttcgacctgagcgtcgactatggcgataaggtc
agcccactgtacgactggcgcccacaatcgacctatatccgccgtcctccttactgggaa
ggcgcattagcgggtgaacgcaccctcaagggcatgcgcccattggccgtactgggtgac
aacatcaccacagaccatttatcaccctcgaacgcgattatgatggacagcgcggcaggc
gaatacctgcacaagatgggtctgccagaggaagacttcaactcctacgcgacccacagg
ggcgaccacttaacggcccagcgtgccaccttcgccaacccaaaactcaaaaacgagatg
gcggttgtcgatggcaaggtgaagcaaggttcactggcgcgtatcgagccagaaggccaa
gtgacccgcatgtgggaagccattgaaacctatatggatcgcaaacagccgctgatcatt
atcgctggcgccgactatggtcagggttcatcccgtgactgggctgcaaaaggcgtgcgc
ttagcgggcgttgaggccattattgccgaaggcttcgagcgtattcaccgtactaactta
gtcggtatgggcgtgttaccgctggagtttaaggcgggcgagaatcgcgctacctatggc
atagatggtaccgaagtgtttgacgtctatggtgaaatcgcgccaagagcggatctcacg
gtcgtgattagccgcaaaaatggcgagcgcgtcgaagtacccgttacctgtcgcctcgat
accgcagaagaagtgtctatctattctgccggcggcgtattgcagcgttttgcgcaggac
tttttagagtcgaatctgaagtaa

DBGET integrated database retrieval system