KEGG   Shewanella bicestrii: CF168_03385Help
Entry
CF168_03385       CDS       T05197                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
sbj  Shewanella bicestrii
Pathway
sbj00790  Folate biosynthesis
sbj01100  Metabolic pathways
sbj02020  Two-component system
Module
sbj_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CF168_03385
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CF168_03385
Enzymes [BR:sbj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CF168_03385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: ASK67983
UniProt: A0A220UJW3
Position
753196..754962
Genome map
AA seq 588 aa AA seqDB search
MKRTVTRRDFLAMSAKGIGAAVISYGLMGCSDSDDDKSVPAQFLHGVASGDPAHDAVILW
TRVTPDSAGDVKVSWQVASDAAFSQLVTTGEMVTNANRDYTVKIDARGLRAGQTYFYRFM
TGGKTSEVGKTRTLPEGDVSSVKLAVMSCANFPAGYFNVYELAAAQDDLDAVVHLGDYIY
EYARGGYASEHAAELGREVLPANELLTLSDYRTRYAQYHTDASLQKLHAKVPFITVWDDH
EVANDTWRDGAENHNEGEGDFAVRKEAALQAYFEWLPIRPWREGNHEEIYRSFSYGNLVD
LHMLDTRVLARDKQLDYADYMDASTGAFDGERFRADVTSTSRTMLGLTQLLWLQGTLLQA
TGTWQVLGQQILMGKMSLPAAIATQQMSIPQYAMLGALAKLAARAAANDPTLTAAELQYL
QANQALLTPEVIALLQLPSIPYNLDAWDGYAYEREVILGTAKSKNHNLVVIAGDTHNAWA
NELKDVNGDTVGVEFATSSVSSPGLEYYLNLPAEQIPATEAAIVDLVPDLKYTNLKDRGF
MTLTFTKEAVRSDWHYVSTILAKEFEESSSRSYSAMTKVGEHIINPVS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaccgtgactcgtcgtgattttttagccatgtcggccaaaggcattggtgca
gcagtgatctcctacggcctaatggggtgtagtgacagtgatgatgataaatctgttcct
gcgcagtttttacatggggtagccagtggtgaccctgcgcatgacgcggtgatcctctgg
acccgtgtgacgccagattctgctggggatgttaaagtcagctggcaagtggccagtgat
gcggcattctcacaattagtgaccacaggggagatggtcaccaatgctaaccgtgattac
acggttaaaatcgatgcccgtggtttacgtgcgggacaaacctatttttaccgctttatg
acgggcggaaaaacctctgaggtgggcaagacccgcactctacccgagggtgatgtgagt
tcggtaaaacttgccgtcatgtcatgcgctaactttcctgccggctattttaacgtgtat
gaattggctgcggcgcaggatgacctcgatgccgtggtgcatctgggtgactatatctac
gaatatgctcgcggcggctatgccagcgaacatgcggcagaacttggccgtgaagtgtta
cccgccaacgaactgctgaccctcagcgactaccgtacccgttacgcccaatatcatacc
gatgccagcctgcaaaaattgcacgcgaaagtgccatttattacggtatgggacgaccac
gaagtagcaaacgatacttggcgtgatggcgccgagaaccacaacgaaggcgaaggggat
tttgcggttcgtaaagaagccgcgctgcaggcttacttcgagtggctgccaatccgccca
tggcgcgagggtaaccatgaggagatttatcgcagcttcagttacggcaacctagttgac
ttacatatgctggatacgcgcgtcttggcccgcgataagcagctcgattatgccgattat
atggatgccagtacgggcgccttcgatggcgagcgtttccgcgccgatgtgacatcgacc
tcgcgcactatgttaggtctgactcagttactctggctacagggcaccttattgcaagcc
accggcacttggcaggtattaggacaacagatcctcatgggcaaaatgtctctacctgcg
gcgattgctacccagcaaatgagcattccacagtatgccatgcttggggcgctggcgaag
ttagccgcccgcgctgcggcaaatgatccaaccctaacggcggcagaattacagtacttg
caggctaatcaagccctgttaacgccagaggtgattgccctgctgcaactgccatctatt
ccctataacttggatgcatgggatggttatgcctatgaaagggaagtgattttaggcacg
gctaaatcgaaaaatcacaacctagtggtgattgccggtgacacccataatgcctgggcg
aatgagcttaaagatgtcaacggcgataccgttggggtcgagtttgccacaagctcagtg
tcatcacctggtttggaatattacttaaatctaccagcggaacagatccccgcgaccgag
gcggcgatcgtcgacttggtgccagatcttaaatacaccaaccttaaagaccgtggcttt
atgacattaaccttcaccaaggaagcggtgcgtagcgattggcattatgtcagcacgatt
ctggcgaaggagtttgaagagtcgagtagccgcagctacagcgccatgactaaggtcggt
gaacatatcatcaaccctgtgagctaa

DBGET integrated database retrieval system