KEGG   Shewanella bicestrii: CF168_06775Help
Entry
CF168_06775       CDS       T05197                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
sbj  Shewanella bicestrii
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbj03016]
    CF168_06775
Enzymes [BR:sbj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CF168_06775
Transfer RNA biogenesis [BR:sbj03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    CF168_06775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ASK68603
UniProt: A0A220ULP9
Position
1553912..1554766
Genome map
AA seq 284 aa AA seqDB search
MNLDDDWLDMPEDKYNPSENDEQSEPAPELRILYQDEHLVAIHKPAGLLVHRSYLARRER
FFAMQLTRDLVGCHVFPVHRLDRPTSGVLLFAKSSEVANALCEQFANHSIEKHYLALVRG
NMHESGVLDYALKVELDEVADKFANQDKAAQDAVTQYEPLLNTEIPYPSGRYATSRFALV
KLSPKTGRKHQLRRHMAHLRHPIIGDTTHGDGKQNAFFRAHFDINRLWLIAKKLTFTHPV
TLKRLSIETELEPEWETVFSGLGWDDAALCCEPSVLIAEQTTTV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagatgatgattggctggatatgccagaggataaatacaatccaagcgagaac
gacgaacagtcagagcctgcgccagagctgcgtatcttgtatcaagacgagcacttggta
gctattcataaacccgcgggattattggttcatcgcagctacttagcgcggcgtgagcgc
ttttttgcgatgcaactgactcgggacttagttggttgccatgtgtttccggtacaccgt
ttagatagacccacctcgggcgtgttgttatttgctaaaagcagtgaggtggccaacgcc
ctatgcgagcaatttgccaaccacagtattgaaaaacactatttggcactggtgcgtggc
aatatgcatgagagtggtgtgttggattatgcgctcaaagtcgaattagatgaggtggca
gacaagtttgccaatcaagataaggccgcgcaggacgctgtgactcaatatgagccgcta
ttaaataccgaaattccttatccgtcggggcgttatgcaactagtcgcttcgcgttagtg
aaactgagtccaaaaacggggcgtaagcaccaactcagacgccatatggcgcatttacgt
cacccgattattggcgataccacccacggcgatggtaagcaaaatgcgtttttccgcgca
catttcgatatcaaccgactgtggctgattgcgaaaaagttaacctttactcacccggtg
acacttaagcgcttaagtatcgaaaccgagcttgaacccgaatgggaaaccgtgttttca
ggactgggttgggatgatgccgcactttgttgcgagccaagtgtcttgattgcagagcaa
acgacgaccgtttaa

DBGET integrated database retrieval system