KEGG   Shewanella bicestrii: CF168_06990Help
Entry
CF168_06990       CDS       T05197                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
sbj  Shewanella bicestrii
Pathway
sbj00360  Phenylalanine metabolism
sbj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbj00790  Folate biosynthesis
sbj01100  Metabolic pathways
sbj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CF168_06990
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CF168_06990
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CF168_06990
Enzymes [BR:sbj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     CF168_06990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ASK68646
UniProt: A0A220UL66
Position
1607145..1607960
Genome map
AA seq 271 aa AA seqDB search
MTKEIAHTAPYVARSADDSGFIHYPQEEHDIWSQLYARQAVNLPGRACKEYLQGLDALAM
PKDRIPQLAEIDKVLQATTGWKTAAVPALISFGRFFELLANKEFPVATFIRRKEEFDYLQ
EPDIFHEIFGHCPLLTNPSFAHFSHIYGQLGLNASKEDRVFLARLYWFTVEFGLLKPQDG
ELCIYGGGILSSPGETLYAMESQVPERKPFDLLDVLRTPYRIDIMQPIYYVIEHIDMLDE
IAKMDIMAYVAKARQLGLFAPKYPPKTKKAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagagatagcgcacactgcgccctatgttgcgcgaagtgcagatgattctggg
tttatccattacccgcaggaagaacatgatatttggagccaattgtatgctcgccaagcg
gtaaacctaccggggcgtgcctgtaaggaatatctccaagggctcgatgccttggcgatg
ccgaaggaccgcattccacaattggctgagattgataaagtcttgcaggccaccacagga
tggaaaaccgcggccgtgccggccttgatttcctttggccgcttctttgagctattggcc
aacaaggaatttccggttgcgacctttatccgccgcaaggaagagtttgattatctgcaa
gagccggatattttccatgagatctttggccattgccccttgctgaccaatccttctttc
gcccatttctcccatatctatggtcaattgggcttaaatgccagcaaggaagaccgcgtc
tttttagcgcgcctgtattggtttaccgtcgagtttggcttgctcaaacctcaggatggt
gaattgtgtatctacggcggcggtattttaagctctcccggcgaaaccttgtatgccatg
gaaagccaagtgccggaacgtaagcccttcgatctcttagatgtgctacgtacgccttac
cgtatcgatattatgcagccgatttattatgtgattgaacatattgatatgctggatgaa
attgccaagatggacatcatggcctatgtggctaaggcgcgtcagttaggcttatttgcc
cctaagtatccgcccaagaccaagaaagccagctaa

DBGET integrated database retrieval system