KEGG   Shewanella bicestrii: CF168_10265Help
Entry
CF168_10265       CDS       T05197                                 

Definition
(GenBank) gluconolaconase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
sbj  Shewanella bicestrii
Pathway
sbj00053  Ascorbate and aldarate metabolism
sbj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    CF168_10265
Enzymes [BR:sbj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     CF168_10265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Arylesterase DUF5122
Motif
Other DBs
NCBI-ProteinID: ASK69222
UniProt: A0A220UMZ1
Position
complement(2336455..2337357)
Genome map
AA seq 300 aa AA seqDB search
MQTVTVGDLLMTIPVGNRLGEGVLWDDLHQSIWWTDILSSVIYRFHLASRSLETFPMPHR
VGSFGLTVKPTTLIVAFDIGIATYDIEDQSLTWLAQPESHFAGNRFNDGRIDRQGRFWAG
TMVERRDTLQQTAALYCLDEKGLCHQHLTNLEISNGLCWSVDGRTLYHADSPKHQIYQYD
FDIEQGLLSRKRLFASTSHHIFPDGSDVDAAGYLWNAQWGGGQVVRYRPDGEVDLILKLP
VTHPTSIAFGGEKRDLLIVTSAKHSLNASQLDQEPQAGDVFIYPLQGIYGVSSPRFGGQL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacggtcacggttggcgatctgttgatgacaatccctgtgggcaaccgccttggt
gaaggtgtgctatgggatgatttacaccaatctatttggtggaccgacattttatcctct
gtgatttatcgttttcatctcgcgagccgctccttagagactttccccatgccgcaccgc
gtcggctcctttggcctcacggtaaagcctacaacacttatcgtcgcattcgatatcggt
attgcaacttatgatattgaagatcaaagcctgacatggttggcgcagccagaatctcat
tttgctggcaatcgctttaatgatggtcggattgataggcaagggcgtttttgggcgggc
actatggttgagcggcgcgatactttgcaacaaaccgcagccctgtattgtctagatgag
aaaggtctttgccaccaacaccttacaaatctcgaaatctccaacggcctgtgctggagc
gtagatgggcgaacgctctaccatgctgattcgccaaaacaccaaatctatcaatatgat
tttgatattgagcaggggttattgagtcgtaagcgcctctttgcgagcacgagccatcat
attttccctgatggttcagatgtcgatgcggcgggttatctctggaatgcccagtggggc
ggtggccaggtggtgcgctatcgtcccgatggtgaagtcgatcttatcctcaaattgccc
gttacccacccaaccagcattgcttttggcggcgaaaagcgtgatttactgatagtcacc
agtgccaaacactcacttaacgcatcgcaattagaccaagagccgcaagcaggcgatgtg
tttatctacccattacagggtatttatggtgtaagcagccctcgttttggcgggcagcta
taa

DBGET integrated database retrieval system