KEGG   Shewanella baltica OS155: Sbal_0372Help
Entry
Sbal_0372         CDS       T00478                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00790  Folate biosynthesis
sbl01100  Metabolic pathways
Module
sbl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal_0372
Enzymes [BR:sbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sbal_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABN59904
UniProt: A3CZJ1
Position
complement(414589..415239)
Genome map
AA seq 216 aa AA seqDB search
MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEILTLMSLDLSDDSLADT
PRRIAKMYVDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTAT
IAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVALQTLLETKDVAVKMDAVHYCV
KSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQSK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtgaagcagcagtaaaagtacaagccgcgttattagaacgtggacttgaa
accccaatgctcccaagcgtttacagcagtgaagaacgtaaagacaagattgaacatcat
atgaaagaaatcctgacattaatgtcattggatctgtcagacgatagccttgccgatacg
ccgcgccgcattgctaaaatgtacgtcgatgaaatcttctccggcttagattatgcgaac
ttccctaagatcacggttatcgacaataagatgggcttcgatgaaatggtgcgagtgcaa
gacattagcctcaccagcacctgcgaacaccatttagtgacgatcgatggtactgcgacc
atagcttatctaccacgcaaaaaaatcattggtttatcaaagattaatcgcatcgtgcgt
ttctttgcccaacgtccacaagtgcaagagcgtttgactcagcaagtgttagtcgcactg
cagaccttgctcgaaactaaagacgttgcggttaaaatggatgctgtgcattactgcgtc
aaatcccgtggcgtgatggactcaaccagttcgaccactaccacagcgctgggcggcatt
ttcaaatctaaccctgcgacccgcgccgagtttttgcaccagtctaaataa

DBGET integrated database retrieval system