KEGG   Shewanella baltica OS155: Sbal_1384Help
Entry
Sbal_1384         CDS       T00478                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00480  Glutathione metabolism
sbl00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sbal_1384
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sbal_1384
Enzymes [BR:sbl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sbal_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABN60902
UniProt: A3D2D9
Position
complement(1591283..1591780)
Genome map
AA seq 165 aa AA seqDB search
MEVNMTTNIYSQSATDIQGNTVSLEQYRGKVLLIVNTASECGFTPQYKGLEALYQEYKGQ
GLVILGFPCNQFGAQEKADEQGIQAFCELNFGVTFPLFSKIEVNGEHTHPLYQYLKKATP
GVLGTQGIKWNFTKFLVNRQGEAIERFASTTKPEALESKIAALLK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaacatgactacgaatatatacagccaatcagcgacagacattcaaggcaac
acagtaagtttagagcagtatcgaggcaaagtactcttgatcgtcaacaccgccagtgaa
tgtggatttacgccgcaatacaagggattagaagcgttatatcaagaatataaaggtcaa
ggattagtgattttgggctttccttgcaatcaatttggcgcccaagaaaaagccgatgaa
caaggtattcaagccttttgtgaattgaattttggcgtgacatttccactattttctaaa
atagaagtgaatggcgaacacacccatccactttatcaataccttaagaaagccactccc
ggtgtattaggcactcaaggtatcaaatggaatttcaccaaatttttagttaatcgccaa
ggcgaagcgattgaacgatttgcatcgaccacgaaacccgaagcgttagaaagtaaaatt
gccgctttgctaaaataa

DBGET integrated database retrieval system