KEGG   Shewanella baltica OS155: Sbal_1484Help
Entry
Sbal_1484         CDS       T00478                                 

Definition
(GenBank) Phenylalanine 4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00360  Phenylalanine metabolism
sbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbl00790  Folate biosynthesis
sbl01100  Metabolic pathways
sbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Sbal_1484
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal_1484
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal_1484
Enzymes [BR:sbl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Sbal_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ABN61002
UniProt: A3D2N9
Position
1725758..1726558
Genome map
AA seq 266 aa AA seqDB search
MTKGTEYIAHRADDTGFIHYPQEEHDIWRQLYARQAVNLPGRACKEYLQGLDALGMPKDR
IPQLAEIDAVLQATTGWKTAAVPALISFGRFFELLANKEFPVATFIRRKEEFDYLQEPDI
FHEIFGHCPLLTNPSFANFSHMYGQLGLHASKEERVFLARLYWFTVEFGILQPKNGPLCI
YGGGILSSPGETLYAMESDVPERQPFDLLDVLRTPYRIDIMQPIYYVIEHIDMLDEIAKM
DIMGYVTKARQLGLFAPKFPPKAKAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaggaacagagtacatcgctcacagagccgatgacactgggtttatccattac
ccgcaagaagagcacgatatttggcgtcagctttacgcccgtcaagccgttaatctcccc
ggtcgtgcctgcaaggaatatctgcaagggctcgatgccttgggtatgccaaaggatcgc
attccgcaacttgccgaaattgatgcggtattacaagcgaccactggatggaaaacggcg
gcggtacctgcgttgatttccttcggccgtttctttgaattactggccaacaaagagttt
cctgtggccacctttattcgccgcaaggaagagtttgattacctgcaagagccagatatc
ttccacgagatttttggccactgccctttgctcaccaatccttcatttgccaatttctct
catatgtatggccagttaggtttacatgccagcaaagaggaaagggtatttttagcgcgt
ttgtactggtttacggttgagtttggcatactgcaacctaaaaatggtcccttatgtatc
tatggcggcggcattttaagctctcccggggaaaccttgtatgcgatggaaagtgatgtg
ccagagcgtcaaccctttgatttgttggatgtgctgcgaaccccatatcggatcgacatt
atgcagccgatttattatgtgattgagcatattgatatgctggatgaaattgccaagatg
gacatcatgggttatgtcactaaggcgcgtcagttaggtttatttgcccctaaatttccg
ccaaaagccaaggcgagttag

DBGET integrated database retrieval system