KEGG   Shewanella baltica OS155: Sbal_2389Help
Entry
Sbal_2389         CDS       T00478                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00230  Purine metabolism
sbl00240  Pyrimidine metabolism
sbl01100  Metabolic pathways
sbl01110  Biosynthesis of secondary metabolites
Module
sbl_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sbl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
sbl_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
sbl_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:sbl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Sbal_2389
   00240 Pyrimidine metabolism
    Sbal_2389
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbl04131]
    Sbal_2389
Enzymes [BR:sbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Sbal_2389
Membrane trafficking [BR:sbl04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Sbal_2389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ABN61882
UniProt: A3D569
Position
complement(2780484..2780915)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIVASKMLHLTKEQAEGFYAEHSERGFF
GALVAFMTSGPIMVQVLEGENAVLAHREILGATNPAQAAPGTIRADFAESIDENAAHGSD
AVESAAREIAYFFSAEELCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaacgcacattttctattatcaaacctgatgctgttgcaaaaaaccacatc
ggtgctatctacaatcgttttgaaactgctggtcttaagatcgttgcatcaaaaatgtta
cacctgactaaagaacaagctgaaggtttctatgctgagcatagcgagcgcggcttcttc
ggtgctctggttgcattcatgacttctggtcctatcatggtccaagtattagaaggcgaa
aacgctgttttagctcaccgtgaaattttaggtgcaactaacccagctcaagcggctcct
ggtactatccgtgctgatttcgctgaaagcattgacgaaaacgcggctcacggctctgat
gctgttgaatctgctgctcgtgaaattgcttacttcttcagcgctgaagaactgtgtcca
cgcactcgttaa

DBGET integrated database retrieval system