KEGG   Shewanella baltica OS155: Sbal_2465Help
Entry
Sbal_2465         CDS       T00478                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00450  Selenocompound metabolism
sbl00970  Aminoacyl-tRNA biosynthesis
sbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Sbal_2465
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sbal_2465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbl01007]
    Sbal_2465
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbl03016]
    Sbal_2465
Enzymes [BR:sbl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Sbal_2465
Amino acid related enzymes [BR:sbl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Sbal_2465
Transfer RNA biogenesis [BR:sbl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Sbal_2465
 Prokaryotic type
   Other AARSs
    Sbal_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Adenyl_transf
Motif
Other DBs
NCBI-ProteinID: ABN61958
UniProt: A3D5E5
Position
2877477..2879546
Genome map
AA seq 689 aa AA seqDB search
MATSQRKILVTSALPYANGPIHLGHMLEYIQTDIWSRYQKLRGHECHYICADDAHGTPIM
LKAQQLGIAPEDMIAQVNKEHQQDFADFNVAFDNYHSTHSEENRLMASDIYLKLRDNGYI
KSKSISQLFDPEKSMFLPDRFVKGTCPKCKSPDQYGDNCDSCGATYSPTELINPKSAVSG
ATPVMKDTEHFFFDLPAFEGMLKEWTRSGALQVEMANKLDEWFEQGLQQWDITRDAPYFG
FEIPDAPGKYFYVWLDAPIGYMGSFKNLCAKRPELSFDEFWGKDSTAEVYHFIGKDIVYF
HSLFWPAMLHGSGYRQPNSVYAHGYVTVNGAKMSKSKGTFIKARTYLDHLDPEYLRYYYA
AKLSSRIDDLDLNLEDFAQRVNSDLVGKLVNLASRTAGFITKRFDGKLAKINDTTLTEAF
LAKQDVIADFYESREYGKAMREIMALADIANGFVADAAPWQMVKHDDQQEAAHQVCSNAL
NLFRILVTYLKPVLPRLAQDVEAFFQLPLTWDALGQDLAGHEIAPFKAMMQRVELDKVNA
MVADSKDNLQVTADAPKTAAPEKIAKASSVSSEPLVSDPISETINFDDFAKIDLRIARIV
KAEHVADADKLLKLQLDIGGETRQVFAGIKSAYSPEDLEGKLTVMVANLAPRKMRFGMSE
GMVLAAGPGGSDLWILEPHEGAQPGMRVK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttcacaacgtaaaattctcgtgaccagcgcacttccctacgcaaacggaccg
atacatttaggtcacatgttggaatacatccagacagatatctggtcgcgttatcaaaaa
cttcgtggacatgagtgccactatatttgtgccgatgacgcccatggcacgccgatcatg
cttaaagcgcagcaattaggcatagcgcctgaagatatgatcgcccaagtgaacaaagaa
catcagcaggattttgccgattttaatgtcgccttcgataactatcacagcactcacagc
gaagaaaaccgcctcatggcgagcgatatttatctcaagctaagggacaacggctatatc
aagagcaagagcatttctcagttattcgatcctgagaaatccatgttcctgcccgaccgc
ttcgtaaaaggtacttgccctaagtgtaagtcacctgatcaatacggcgataactgtgat
tcttgcggcgcgacttacagcccaactgaactgatcaatccaaaatcagcggtatcgggt
gcaacgccagtgatgaaagacactgagcactttttcttcgacctgcccgccttcgaaggc
atgctaaaagagtggactcgctctggcgcactgcaagtcgaaatggccaataaactcgac
gaatggtttgagcaaggtctgcagcaatgggatatcacccgtgatgcaccgtattttggc
tttgaaattcccgatgcaccgggcaagtatttctatgtttggttagatgcgcctatcggc
tatatgggttcattcaaaaacctgtgtgcaaaacgtcctgagttgagcttcgatgaattc
tggggcaaagattctactgctgaggtttatcacttcatcggtaaagacatcgtttacttc
catagcctcttctggccagccatgctgcacggctcaggttatcgtcagccaaacagcgtc
tatgcccacggttatgtgacggtcaatggcgcgaagatgtcaaaatcgaaaggcacgttc
attaaggcgcgtacctatttagatcatttagatcctgaatatttacgttactactacgcc
gctaaactcagcagccgtatcgacgatttagatttaaatctggaagatttcgcccagcgc
gtgaactcagatttagtcggtaaactagtgaacttagcctcgcgcacagcaggttttatc
actaaacgcttcgatggcaagctagcgaaaattaacgacactaccctgaccgaagcgttt
ttagccaagcaagacgtgattgccgatttttacgagtcgcgcgaatacggcaaagcgatg
cgcgaaatcatggcgctggcggatattgccaacgggtttgtggctgatgctgcaccttgg
caaatggtgaaacatgacgatcaacaggaagctgcccatcaagtgtgttcaaacgccttg
aatctgttccgtattctcgtgacgtatctaaaacctgtattgccacgtttagcccaagat
gtggaagccttcttccaactgccactcacttgggatgcattgggccaagatttagcgggt
catgaaatcgccccattcaaggcaatgatgcaacgtgttgagctggataaagtcaatgcc
atggttgctgattccaaggataacctgcaagtcacggcggatgcaccaaagacggcagca
cctgaaaaaatagctaaagcttcatcggttagcagtgagccgctggttagtgatcctatc
agtgagaccatcaactttgatgattttgcgaaaatcgacctgcgtatcgctcgcatcgtc
aaagcagagcatgttgctgacgctgacaagttactcaagttacaactcgacatcggtggt
gaaacgcgccaagtgtttgccgggatcaaatcggcctattcgccagaagatctcgaaggc
aagttgactgtgatggtggcgaacttagcgccacgtaagatgcgttttggcatgtcagaa
ggcatggtgttggccgcaggacctggtggtagcgacctgtggattttagaaccccatgaa
ggcgcacagcctggcatgcgggttaagtaa

DBGET integrated database retrieval system