KEGG   Shewanella baltica OS155: Sbal_2513Help
Entry
Sbal_2513         CDS       T00478                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00020  Citrate cycle (TCA cycle)
sbl00640  Propanoate metabolism
sbl00660  C5-Branched dibasic acid metabolism
sbl01100  Metabolic pathways
sbl01110  Biosynthesis of secondary metabolites
sbl01120  Microbial metabolism in diverse environments
sbl01130  Biosynthesis of antibiotics
sbl01200  Carbon metabolism
Module
sbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal_2513
   00640 Propanoate metabolism
    Sbal_2513
   00660 C5-Branched dibasic acid metabolism
    Sbal_2513
Enzymes [BR:sbl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sbal_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABN62006
UniProt: A3D5J3
Position
complement(2934909..2936075)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKSLFAEYGLPVSEGFACDTAQEAVEAAGHIGGNLWVVKCQVHAGGRGKAGGV
KVTGDKEEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRATRR
VVFMASTEGGVEIEKVAEETPELIHTAIIDPLTGPQGYQARDLGFKLGLNPTQMKQFTKI
FMGLATMFVDHDFALLEINPLVITTEGNLHCLDGKIGIDGNALYRQPKIKGMHDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LAKSGLDIIAATSLTDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaatccttatttgccgaatatggtttaccagtgtca
gaaggttttgcatgtgatacagcccaagaagctgtagaagcggcaggccatattggcgga
aatttatgggttgttaagtgtcaagtacacgctggcggccgcggtaaagcgggtggcgtt
aaagtcactggcgataaagaagaaatcagagcctttgccgaacactggttaggcaaaaat
ctggtgacttatcaaactgatgagaaaggtcagccagttgctaaaattttagtagaaagc
tgcaccgacatcgctaacgaactgtacctaggtgccgttgttgaccgcgcgactcgtcgc
gtagtgttcatggcgtcgactgaaggtggtgttgaaattgagaaagtggcagaagaaacg
ccagaactcatccacactgcaatcatcgatcctttgactggtccacaaggttatcaagca
cgtgatcttggcttcaagttaggtttaaacccaactcaaatgaagcagttcactaagatt
ttcatgggtctggcgactatgttcgttgatcatgatttcgcattgcttgaaatcaaccca
ctggttattaccactgaaggcaacctacactgcctagacggtaaaatcggtatcgacggt
aacgcactttatcgtcaaccaaaaatcaaaggtatgcacgatccatcacaggatgatgcc
cgcgaagctcacgctgctaagttcgaactgaactatgtagcgttagacggtaacgttggc
tgtatggtgaacggtgcaggtctggctatgggtactatggatatcgttaacttgcacggt
ggcaagccagcgaacttcctagacgtaggcggcggcgcgactaaagaacgtgtagcagaa
gctttcaaaatcattctgtctgacagcaatgtgaaagcggttctggttaacattttcggc
ggtatcgtacgttgtgacatgatcgcagaaggtattatcggcgctgttaaagaagtcggc
gttaaagtacctgttgtagttcgtttagaaggtactaacgctgaacttggccgtgaagta
ttagctaaatcaggtcttgatatcattgcagctaccagtctgactgacgcggctgagcaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system