KEGG   Shewanella baltica OS155: Sbal_3243Help
Entry
Sbal_3243         CDS       T00478                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00010  Glycolysis / Gluconeogenesis
sbl00051  Fructose and mannose metabolism
sbl00562  Inositol phosphate metabolism
sbl01100  Metabolic pathways
sbl01110  Biosynthesis of secondary metabolites
sbl01120  Microbial metabolism in diverse environments
sbl01130  Biosynthesis of antibiotics
sbl01200  Carbon metabolism
sbl01230  Biosynthesis of amino acids
Module
sbl_M00002  Glycolysis, core module involving three-carbon compounds
sbl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal_3243
   00051 Fructose and mannose metabolism
    Sbal_3243
   00562 Inositol phosphate metabolism
    Sbal_3243
Enzymes [BR:sbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sbal_3243
Exosome [BR:sbl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sbal_3243
  Exosomal proteins of bladder cancer cells
   Sbal_3243
  Exosomal proteins of melanoma cells
   Sbal_3243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABN62723
UniProt: A3D7L0
Position
complement(3802350..3803132)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcggcatta
gcccaagagttgttcaaaaaatttgcctctaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagagagcgttaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgcacaaaacctaagtcaacacgactttggc
gcttataccggagaagtttcaggtcagatgctcaaagattcaggatgtcgatatgtgatt
atcggacattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgccgctgcacaaaagcatggcttaactcccattttatgtgtgggtgagtcaggtcca
gcacgtgaagcaagacgcaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaacggcactatggcttttgataacgccattatcgcctacgagccactttgggctgta
gggacaggtaaaagcgctacaccagagcaggcacaagaagttcatgcgtttattcgcaaa
cgcctctctgaagtgtctccttttatcggagaaaatatcaggattctctacggtggtagt
gtaacaccgagtaatgctgcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgctagcttaaactctagcgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system