KEGG   Shewanella baltica OS155: Sbal_3361Help
Entry
Sbal_3361         CDS       T00478                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00860  Porphyrin and chlorophyll metabolism
sbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sbal_3361
Enzymes [BR:sbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Sbal_3361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 BPL_N
Motif
Other DBs
NCBI-ProteinID: ABN62838
UniProt: A3D7X5
Position
complement(3926548..3928230)
Genome map
AA seq 560 aa AA seqDB search
MSSPNTDNTDCATALYTANTVAIHPAANLAVNTPAVNSAVNRSAVNSPRRTKVLMVQGTT
SDAGKSTLVAGICRLLAREGVKVAPFKPQNMALNSAVTIDGGEIGRAQALQAVACYLEPH
TDFNPILLKPSSDTGAQIIVHGKALTTLEASAFFGPKSKDYKAMALGAVLESFERLSGQY
QTIVVEGAGSPAEINLREGDIANMGFAEAVDCPVIIIADIDKGGVFAHLVGTLALLSESE
QARVKGFVINRFRGDISLLQSGLDWLEAYTNKPVLGVLPYLHDLHLDAEDALISSPTKGA
NSRFKVRVLVYPRISNHTDFDPLRLHPDIDFDYVSLQTQAASHATHLPAADLLILPGSKN
VRADLAFLRQQGWDKDIDTHLRYGGKVLGICGGYQMLGQSIADPLGIEDSAGDTEGLGYL
PLSTELKADKQLRRVSGELTLLGQKVAVKGYEIHCGESRYLIPRLEQMNAPLQLIPESTS
VSFADGLQSDDGQILGTYLHGLFDSPDTCQLILRWAGLNDAKTIDINQIREQQLDRLADV
LVEHLDMQKLQTILDAAVQR
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctccaaacacagacaacaccgactgtgcaactgcactctataccgctaacact
gttgctattcatcctgcggctaatcttgcagtgaatacgccagcggttaattctgcggtg
aataggtctgctgttaattcacctcggcgtacaaaagtcttgatggtgcagggcacaacg
tcggatgcgggtaaaagcaccttagtggcaggcatttgtcgtttgctcgcccgagagggc
gtaaaggttgcgccctttaagccgcaaaatatggcgctcaatagcgctgtaactattgat
ggcggcgagatcggccgcgcacaggcgttgcaagccgtggcctgttatcttgagccccat
accgattttaatcctattctgcttaaacctagctcggacacgggcgcgcaaattatcgtt
cacggcaaagcgctgacgacgctcgaagcctcggccttttttgggcctaaatctaaggat
tacaaggcaatggcgctcggtgctgtgctggaatccttcgagcgattaagtggccagtat
caaaccatagtggtggaaggcgcggggagtccggcggagatcaatctgcgcgagggcgat
attgccaacatgggatttgccgaagctgtagattgcccagtgattattattgccgatatc
gataaaggtggcgtatttgcccatttggtcgggacgctggcgctgttatctgagtctgaa
caggcgcgggtaaagggctttgtgatcaatcgtttccgtggcgatattagcctgttgcaa
tctggcctcgattggcttgaagcttatacgaacaagcctgttttaggcgtgttgccttat
ctgcatgatttgcatctcgatgccgaagatgcgctgataagctcgccgactaaaggcgct
aacagccgctttaaagtgcgggtattagtgtacccaaggatcagtaatcacacggatttt
gatccgctgcggttgcatcccgatatcgattttgactatgtgtcattgcaaacccaagcc
gcgagtcacgccactcatttgcccgccgccgatttattgatcttgcccggcagtaagaat
gtgcgtgccgatttggcctttttacgccagcaaggttgggataaggatatcgacacacac
ctgcgttacggcggcaaagtgctcggcatttgcggcggttaccaaatgttaggccaaagc
attgccgatcccttagggattgaagacagtgcgggcgataccgaaggacttggctactta
ccattgagcacagaactgaaagccgataaacagttacggcgggtgagcggtgagctaacg
ttacttgggcaaaaggttgcagtgaagggctatgaaatccactgcggcgaatcacgttat
cttatccctaggcttgaacaaatgaatgcgcccttgcagttaatccctgaatccacatct
gtgagctttgctgatggcctgcaaagcgatgacgggcaaatccttggcacttatttacat
gggctgtttgatagccctgatacctgtcagttgattttacgttgggcgggattaaacgat
gctaagaccatagatatcaatcaaatacgtgagcagcaactcgatcgtttagccgatgtg
ctagtcgagcatctagacatgcaaaaattacagactattttggatgctgcagttcagcgt
tga

DBGET integrated database retrieval system