KEGG   Shewanella baltica OS155: Sbal_4001Help
Entry
Sbal_4001         CDS       T00478                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00860  Porphyrin and chlorophyll metabolism
sbl01100  Metabolic pathways
sbl01110  Biosynthesis of secondary metabolites
sbl01120  Microbial metabolism in diverse environments
Module
sbl_M00121  Heme biosynthesis, glutamate => heme
sbl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sbal_4001
Enzymes [BR:sbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sbal_4001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABN63468
UniProt: A3D9Q5
Position
4689386..4690084
Genome map
AA seq 232 aa AA seqDB search
MVDALNERGIAHWVTPLLCVEATPAIATNTPHPLAHADMIICISANAVTFADNTLTTTNP
PHKAWPPAQYFAVGHATWDALNQLGISALEAPDDCQQTEGLLTLVPLQEIKGQQITIIRG
VGGREALAEQLAARGAHLRYWEVYQRACPPLDGQQLALQWQAFGIDTIVVTSGEVLDNLI
NLVPKELFAWLRSCHIIVPSNRVEAQAHAFGITQVTNANAANSKAVLNALKL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatgccttgaatgaacgaggtattgcccactgggtcacacctctgctgtgtgtc
gaagcaacgcccgctatcgcaacgaataccccgcatcctttggcacacgccgatatgatt
atctgcatcagcgccaatgctgtgacttttgcggataacaccttaactactacaaatcca
ccccataaagcttggcctccagctcagtacttcgcggtagggcatgcgacttgggacgca
ttaaaccaactcggtatttctgccctagaagcccctgatgactgtcagcagaccgaaggg
ctactcacgctcgtgccgctgcaagagattaaaggtcagcagattactattatacgtggc
gtcggtggccgcgaagccttagccgaacaactggctgcgcgcggtgcacatttgcgctat
tgggaagtgtatcaacgagcttgtccgccactcgatggtcaacagttagctctgcaatgg
caagccttcgggatagacacgattgtggtgaccagcggtgaagtactggataacctgatt
aatttagtgccaaaagagttatttgcatggctgcgctcatgtcatatcatagtcccaagt
aaccgagtagaagctcaagctcacgcctttggtataacccaagtcaccaatgccaatgcc
gccaacagcaaagccgtgctaaacgcccttaaactctaa

DBGET integrated database retrieval system