KEGG   Shewanella baltica OS185: Shew185_0016Help
Entry
Shew185_0016      CDS       T00571                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00071  Fatty acid degradation
sbm00280  Valine, leucine and isoleucine degradation
sbm00281  Geraniol degradation
sbm00310  Lysine degradation
sbm00362  Benzoate degradation
sbm00380  Tryptophan metabolism
sbm00410  beta-Alanine metabolism
sbm00640  Propanoate metabolism
sbm00650  Butanoate metabolism
sbm00903  Limonene and pinene degradation
sbm00930  Caprolactam degradation
sbm01040  Biosynthesis of unsaturated fatty acids
sbm01100  Metabolic pathways
sbm01110  Biosynthesis of secondary metabolites
sbm01120  Microbial metabolism in diverse environments
sbm01130  Biosynthesis of antibiotics
sbm01200  Carbon metabolism
sbm01212  Fatty acid metabolism
Module
sbm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Shew185_0016
   00650 Butanoate metabolism
    Shew185_0016
  Lipid metabolism
   00071 Fatty acid degradation
    Shew185_0016
   01040 Biosynthesis of unsaturated fatty acids
    Shew185_0016
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shew185_0016
   00310 Lysine degradation
    Shew185_0016
   00380 Tryptophan metabolism
    Shew185_0016
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shew185_0016
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Shew185_0016
   00281 Geraniol degradation
    Shew185_0016
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shew185_0016
   00930 Caprolactam degradation
    Shew185_0016
Enzymes [BR:sbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Shew185_0016
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Shew185_0016
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Shew185_0016
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Shew185_0016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABS06189
UniProt: A6WHA0
Position
complement(20698..22848)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLASLDAALDSIKQDSNIKALVLTSS
KDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCET
ILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRAEDALK
VGAVDSVVAPQALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGMV
FAVAGKHYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQFVK
GKAKKAGKLAKEVNNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAAKLL
SAQVARGRSTPEKMAKVLNNITPSLDYAAIKHSDVVVEAVVEHPKIKAQVLAEVEGYVSE
DAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSRGKP
KKDVDPTSYGLLKDAFGELKAFEADDIIARTMIPMIIETVRCLEEGIVASPAEADMGLVY
GLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTLAANNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacaattcaggttgagttactcgaggataatattgccaagctg
tgctttaacgcacccggttcggtgaacaaattcgacagagaaaccctcgcctcgctcgat
gcggcattagacagcatcaagcaagattccaatatcaaagcgttagtgctgacctcaagt
aaagatacctttattgtgggcgccgacattaccgaatttttaggcctgttcgcacaagat
gacgccgtattgctctcttgggttgaacaagctaacgcagtcttcaacaaactcgaagac
ttgcctttcccaactgcatcagcaatcaaaggctttgccttaggtggcggctgtgaaacc
attctggcaaccgatttccgtatcgcagacaccacagccaaaatcggtttacctgaaact
aaactcggcatcatcccaggttttggcggcacagttcgtctgccacgtgtgattggtgca
gataacgcacttgagtggatcacgaccggtaaagaccaacgcgctgaagatgcactgaaa
gtcggcgctgttgattccgtggttgcaccacaagcgttagaagctgctgcgattcaaatg
ctgaaagatgctgttgctgaaaagctggattggcaagcacgtcgtaaccgtaaactgtct
gcgctaacactgccaaaacttgaagctatgatgtcattcaccacagccaaaggcatggtg
tttgcggttgcgggtaaacactaccctgcaccaatggctgctgtaagcgtaattgagcaa
gcatcgactaaaggtcgtgctgaagcattacaaatcgaacatcaagcctttatcaagctg
gctaaaactgacgtagctaaagcacttatcggtattttccttaatgatcaatttgttaaa
ggtaaagcgaagaaagccggcaagttagcgaaagaagtcaacaacgcggccgtattaggc
gcaggcattatgggcggcggcatcgcttaccaaagcgccagcaaaggcacaccgattgtc
atgaaagacattgcccagccagcattagatttaggcctcaatgaagccgctaaactgcta
tctgcccaagtcgcccgtggccgttcaacgccagaaaaaatggccaaagtgctgaacaac
atcacgccttcattagattatgccgcgattaaacacagtgatgtcgtcgttgaagccgtt
gttgaacatccaaaaatcaaagcacaggttttagccgaagttgaaggctatgtgagtgaa
gatgcaattatcgcgtcaaacacttcaacgatttcaatcaacttgctcgctaagagcatg
aagaaacctgaacgtttctgcggtatgcatttcttcaacccagtgcacaaaatgcctttg
gtcgaagttatccgtggcgagcatagctctgaagaaaccatcgcctctgttgtggcttat
gccagcaaaatgggcaagaccccaatcgttgttaatgattgccctggcttcttcgttaac
cgcgtactcttcccttactttgcaggctttaacggcttacttgccgaaggtggcgacttt
gctgcaatcgacaaagtgatggaaaaacaattcggttggccaatgggtccagcttacctg
ctcgacgtagtcggtttagacacaggtcatcacgcccaagctgttatggctgaaggtttc
cctgatcgcatgggtaaatcaggcactgacgcgattgatgtgatgtttgagaacaaacgt
cttggccagaaaaatggtaaaggtttctatgtctattcagtcgatagccgtggcaagccg
aagaaagatgtcgatccaacgagctacggcctattgaaagatgcctttggcgagttaaaa
gcctttgaagccgatgacattattgcccgtactatgatccctatgatcatcgaaaccgtg
cgctgtttagaagaaggtattgtcgcatcgcctgccgaagcggatatgggcctagtttat
ggcttaggtttcccgccattcagaggcggcgtgttccgttacttggataccatgggtgtc
gcaaattttgtggccttagcagacaaatatgctcacttgggcggtctgtatcaagtcaca
gatgcgatgcgcacattagcagccaataacggtagctactaccaagcctaa

DBGET integrated database retrieval system