KEGG   Shewanella baltica OS185: Shew185_0717Help
Entry
Shew185_0717      CDS       T00571                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00473  D-Alanine metabolism
sbm01100  Metabolic pathways
sbm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Shew185_0717
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Shew185_0717
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_0717
Enzymes [BR:sbm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Shew185_0717
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Precursor biosynthesis
  Racemase
   Shew185_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABS06874
UniProt: A6WJ85
Position
859263..860339
Genome map
AA seq 358 aa AA seqDB search
MNPFPRAEISSSALQTNLAALRQQAPASRVMAVVKANGYGHGLLNVANCLVSADGFGLAR
LDEALELRAGGVTARLLLLEGFFRATDLPLLVGHDIDTVVHHSSQLEMLEQTVLSKPVTV
WLKVDSGMHRLGFTPEQFSTVYARLMACPNVAKPIHLMTHFACADEPDNSYTSVQMAAFN
SLTAGLPGFRTLANSAGALYWPQSQGDWIRPGIALYGVSPVTGDCGANHGLVPAMELVSQ
LIAVRDHKANQPVGYGCFWTAKQDTRLGVVAIGYGDGYPRNAPEGTPVWVNGRRVPIVGR
VSMDMLTVDLGQDAQDKVGDSALLWGKALPVEEVAEHIGTIAYELVTKLTPRVAVCLA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgaacccttttccccgtgcagaaattagcagtagtgcactgcaaaccaatctcgctgcg
ttgcgtcaacaggcaccagcgagtcgcgtaatggccgtcgttaaagcgaacggctatggt
catggattattgaatgtcgctaattgtttagtcagtgccgatggctttggcttagcacga
ttggatgaagccttagaattacgagcgggcggcgtgacagcgcggttgttattgctggaa
ggttttttccgcgccaccgatttacctttgctcgtcgggcatgatatcgacactgtggtg
caccatagttctcagctggagatgttggagcaaactgtattgtctaagcctgtgactgtt
tggctgaaggtcgattcaggcatgcaccgcttaggctttacacccgagcaattttcaacg
gtttacgcaaggttaatggcctgtcccaatgtggcaaaaccgattcatttaatgacgcat
tttgcctgtgcagatgagcctgataatagttatacctcagtgcagatggcggcttttaat
agcttaacggctggcttgcccggatttagaaccttagccaactccgccggtgctttgtat
tggccgcaaagccaaggcgattggatccgtccgggaatcgcactctatggtgtgtcaccc
gtcactggagattgcggtgcgaatcacggactggtacctgcgatggaactggtatcacag
ttgattgcggtgcgggatcataaagccaatcagccagtgggttatggttgtttctggacc
gcgaagcaagatacccgtttaggtgtcgtcgcaattggttatggtgatggttatccccgc
aatgcaccggaaggtacacctgtgtgggtcaatggtcgtcgcgtacccatagtaggccgc
gtctctatggacatgttgactgtcgacttaggccaagatgcgcaggataaggttggcgat
agcgctttgttgtggggtaaagcattacccgtagaagaagtcgctgagcatattggtact
atcgcttatgaattagtcactaagctcaccccaagggttgcggtttgtttagcttag

DBGET integrated database retrieval system