KEGG   Shewanella baltica OS185: Shew185_0943Help
Entry
Shew185_0943      CDS       T00571                                 

Definition
(GenBank) 6,7-dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00633  Nitrotoluene degradation
sbm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Shew185_0943
Enzymes [BR:sbm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     Shew185_0943
  1.-  
   1.-.-  
    1.-.-.-  
     Shew185_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase DUF3268
Motif
Other DBs
NCBI-ProteinID: ABS07097
Position
complement(1124251..1124904)
Genome map
AA seq 217 aa AA seqDB search
MSDLNFLAKKRYTTKAFDPTKTIPAEKIADIKTLLQFSPSSVNSQPWHFVLASTAEGKAL
IAQATENYAFNTQKILNASHVVVLCTRTQLDEAYLLQILEQEEKDGRLANEEAKQAQHNG
RSFFANMHKFEMKDAQHWMEKQVYLALGTLMLGASVLDIDTCPIEGFDATKMNQVLGLRE
QGLCACVVVAMGYHAEDDFNAKLPKSRLDQEVIFTEI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttaaatttcttagccaaaaaacgttacaccactaaagcctttgatccaaca
aagacgattccagcggaaaaaattgcagacatcaaaaccctgctacaattcagcccttcg
tcagttaactcacagccttggcattttgtactagcaagcacggccgaaggtaaagcttta
atcgcccaagcaaccgagaattatgcctttaatacccaaaaaatcctcaatgcttcccat
gtggtggtgctctgcactcgcactcaattagatgaagcgtatttgctgcaaatccttgaa
caagaagaaaaagatggccgcttagctaatgaggaagcaaaacaagcccagcataatggc
cgctctttcttcgccaacatgcataaatttgagatgaaagatgcccaacattggatggag
aaacaggtctatttagcgctcggcactttaatgctcggcgcaagcgtattagatatcgat
acttgtccgattgaaggttttgatgccactaaaatgaatcaagtcttaggcttaagagag
caaggtctatgtgcctgcgtagttgtcgctatgggttatcacgcagaggatgatttcaac
gctaaattgcctaagtctcgcttagatcaagaggtgatttttactgaaatctag

DBGET integrated database retrieval system