KEGG   Shewanella baltica OS185: Shew185_1045Help
Entry
Shew185_1045      CDS       T00571                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
sbm  Shewanella baltica OS185
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Shew185_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ABS07197
UniProt: A6WK58
Position
complement(1240813..1241193)
Genome map
AA seq 126 aa AA seqDB search
MSALDTSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGNT
SEVQGAGVVGETPTIAPNTAYQYTSGTVLDTPLGIMHGTYGMVSESGEHFQATIRPFRLA
TPGLLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattggacacctccattcgggttgaagttaaaactgaatatatagagcagcag
tcctcgcccgaggatgaaaaatacctcttcagctataccatcactatcatcaatttaggt
gagcaggcggctaaactcgaaacccgtcactggataatcacagatgccaatggcaatacc
agtgaagtccaaggcgccggagttgtcggtgaaacaccaaccatagcgccaaataccgcc
tatcaatacaccagtggcacagtgctcgatacaccccttggcataatgcatggcacttat
ggtatggtcagcgaatcgggtgagcatttccaagcgacgatccgtcccttccgtttagcg
accccaggcttactacactaa

DBGET integrated database retrieval system