KEGG   Shewanella baltica OS185: Shew185_1368Help
Entry
Shew185_1368      CDS       T00571                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00480  Glutathione metabolism
sbm00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Shew185_1368
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Shew185_1368
Enzymes [BR:sbm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Shew185_1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABS07518
Position
complement(1648183..1648680)
Genome map
AA seq 165 aa AA seqDB search
MEVNMTTNIYSQSATDIQGNTVSLEQYRGKVLLIVNTASECGFTPQYKGLEALYQEYKDQ
GLVILGFPCNQFGAQEKADEQGIQAFCELNFGVTFPLFSKIEVNGEHTHPLYQYLKKAAP
GVLGTQGIKWNFTKFLVNRQGEAIERFASTTKPEALESKIAALLK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaacatgactacgaatatatacagccaatcagcgacagacattcaaggcaac
acggtaagtttagagcagtatcgaggcaaagtactcttgatcgttaacaccgccagtgaa
tgtggatttacaccgcaatacaagggattagaagcattatatcaagaatacaaagatcaa
ggattagtgattttaggctttccttgcaatcaatttggcgcccaagaaaaagccgatgag
caaggaattcaagccttttgtgaattgaattttggcgtgacgtttccgctattttctaaa
atagaagtgaatggcgaacatacccatccactttatcaataccttaagaaagccgctccc
ggtgtattaggtactcaaggtatcaaatggaatttcaccaaatttttagttaatcgccaa
ggcgaagcgattgaacgatttgcatcgaccacgaaacccgaagcgttagaaagtaaaatt
gccgctttgctaaaataa

DBGET integrated database retrieval system