KEGG   Shewanella baltica OS185: Shew185_1489Help
Entry
Shew185_1489      CDS       T00571                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00071  Fatty acid degradation
sbm00072  Synthesis and degradation of ketone bodies
sbm00280  Valine, leucine and isoleucine degradation
sbm00310  Lysine degradation
sbm00362  Benzoate degradation
sbm00380  Tryptophan metabolism
sbm00620  Pyruvate metabolism
sbm00630  Glyoxylate and dicarboxylate metabolism
sbm00640  Propanoate metabolism
sbm00650  Butanoate metabolism
sbm00900  Terpenoid backbone biosynthesis
sbm01100  Metabolic pathways
sbm01110  Biosynthesis of secondary metabolites
sbm01120  Microbial metabolism in diverse environments
sbm01130  Biosynthesis of antibiotics
sbm01200  Carbon metabolism
sbm01212  Fatty acid metabolism
sbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shew185_1489
   00630 Glyoxylate and dicarboxylate metabolism
    Shew185_1489
   00640 Propanoate metabolism
    Shew185_1489
   00650 Butanoate metabolism
    Shew185_1489
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Shew185_1489
   00072 Synthesis and degradation of ketone bodies
    Shew185_1489
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shew185_1489
   00310 Lysine degradation
    Shew185_1489
   00380 Tryptophan metabolism
    Shew185_1489
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shew185_1489
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shew185_1489
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Shew185_1489
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbm04147]
    Shew185_1489
Enzymes [BR:sbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Shew185_1489
Exosome [BR:sbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shew185_1489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABS07639
Position
1798329..1799519
Genome map
AA seq 396 aa AA seqDB search
MSTEQLNQDIVIVAAKRTPMGGFQGNLSSVASPMLAATAIKGLLAETQLAGEHVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARSGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKTEITPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAF
TKDGTITAANSSSISDGAAALMLTSRGEADRLGLAVLATIKGHTTHAQEPSLFTTAPVSA
MAKLLANVGWSTDEVDLFEINEAFAMVTMLAVSELGLDIAKVNVNGGACALGHPIGCSGS
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacagttaaatcaagatatcgttatcgttgccgctaaacgcaccccaatg
ggcgggtttcaaggcaacttgtcatctgtagcatcacccatgttagccgcgaccgccatt
aaaggcttgttagcggaaacacaattggcgggtgagcatgttgatgaagtcttgatgggc
tgcgtattacccgcaggcttaggccaagcgcctgcacgtcaggcaactttgggtgcggga
ttacccttatccgttggtgcgaccacagtgaacaaagtctgtggttcaggcatgaagacg
gtaatgttagcccacgatttgattaaagcgggcagtgcaaaagtggtgatcgcaggcggc
atggaaagcatgagccaagcgccgtatttactcgataaagcccgcagcggcatgcgcatg
ggccatggcaaagtgttagatcacatgtttttagatggtcttgaagatgcctacacgggc
ggtgctatggggacgttcgcccagaaaacggccgatgaatttggtatcacccgcgagcag
atggacgcttttgccttaagctcgctcgaaaaagccaatgccgcgattaactcgggtgcc
tttaaaaccgaaatcacccccgtcacagtcagtgatcgtcgtggtgatgtgactatcgat
accgacgagcaacccggtaatgcccgccctgaaaaaattcctacgctgcgcccagccttt
accaaagatggcactatcacagcggcaaactctagctctatttccgatggcgcagcggca
ttaatgttgacctcgcgcggcgaagctgaccgtttaggtttagccgtgttagccaccatt
aaaggtcatacaacccacgcccaagagccttcattgttcaccactgcaccggttagcgct
atggcgaaattgctggccaatgtcggttggtcaacggacgaggtggatttattcgaaatc
aacgaagccttcgctatggtgactatgcttgctgtgtctgaacttggtttagatatcgct
aaggtaaacgttaatggcggcgcctgtgccttaggtcatccgattggctgctcgggttca
cgtttgctggtgaccttaattcatgctttaaaagcccgcggcctgaagcgcggtgttgcc
tcgctgtgtatcggcggtggtgaagcgacggcgatggccatcgaggtctaa

DBGET integrated database retrieval system