KEGG   Shewanella baltica OS185: Shew185_2130Help
Entry
Shew185_2130      CDS       T00571                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00030  Pentose phosphate pathway
sbm00480  Glutathione metabolism
sbm01100  Metabolic pathways
sbm01110  Biosynthesis of secondary metabolites
sbm01120  Microbial metabolism in diverse environments
sbm01130  Biosynthesis of antibiotics
sbm01200  Carbon metabolism
Module
sbm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sbm_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
sbm_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shew185_2130
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Shew185_2130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbm04147]
    Shew185_2130
Enzymes [BR:sbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Shew185_2130
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Shew185_2130
Exosome [BR:sbm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Shew185_2130
  Exosomal proteins of colorectal cancer cells
   Shew185_2130
  Exosomal proteins of bladder cancer cells
   Shew185_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N COX_ARM
Motif
Other DBs
NCBI-ProteinID: ABS08272
Position
2541904..2543376
Genome map
AA seq 490 aa AA seqDB search
MGKTTSGAKACDFVLFGTKGDLARRKLLPSLYQLDKAELLDKDTKVIGVAKDEFTQDEFI
ELVTLALNTFVKEPLCEETLQRFLSRCHYIGTNFTDSAGYSAFHELLKPEERVMVSYFAT
PPAIFGDICRCLHEQDLIHPDSRVVLEKPIGSDLDSSRVINDQVSAYFKERQVYRIDHYL
GKETVQNLIALRFANSLFASKWDNRTIDHVQITVAEEVGIEGRWGYFDKAGQMRDMIQNH
LLQVLTLVAMDPPVNLDADSIRDEKVKVLKSLRPINSDNVYENTVRGQYSAGFLKGSPVP
GYLEEEGANLQSHTETFVAIRVDIDNWRWAGVPFYLRSGKRMPFKSSEIVVYFKNPPHNL
YRSSYRNLPPNKLTIRLQPHEGVEIQMMNKVPGLEQKQRLQTTKLDLSFSDTFKNERIAD
AYERLLLEAMLGNQALFVRRDEVEQAWTWVDGIIQSWEQSNEKPKPYPAGTWGPVASVAL
ITKDGRSWDE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaacaacatcaggcgccaaagcttgtgacttcgtactctttggtactaaaggc
gatttggcacgacgcaagttgttaccttctttataccagctagataaagctgaacttctc
gataaagatacgaaagtgatcggtgtcgcgaaagatgagtttactcaagatgagtttatc
gaattagtcacgcttgcattaaacaccttcgtgaaagagcctttgtgcgaagagactctc
caacgtttcctgtcccgctgccactatataggcactaactttaccgattcagcgggctac
agtgccttccatgaactgctcaaaccagaagagcgcgtcatggtcagttactttgctacg
ccacctgccatattcggcgacatatgccgttgtttgcatgaacaagatcttatccaccca
gattcacgtgtggtgctcgaaaagccaatcggctcagatttagactcttctcgcgttatc
aatgatcaagtttccgcttacttcaaagaacgtcaggtttaccgtatcgaccattactta
ggtaaagaaaccgtacagaacttgattgccctgcgttttgctaactctttatttgcctct
aagtgggacaaccgtacgattgaccacgtccagatcacagtagcagaagaagtgggtatc
gaaggccgttggggttacttcgacaaagcgggtcagatgcgcgacatgatccaaaaccat
ttgctacaagtgttaacgctcgttgctatggatccaccagtcaacttagacgctgacagc
atccgtgatgaaaaagtcaaagtgctcaaatcactacgtccgattaattctgacaatgtg
tatgaaaataccgtacgcggtcagtacagcgcaggcttcttaaaaggcagcccagtaccg
ggttatttagaagaggaaggcgctaaccttcagtcacacacagaaaccttcgtggcgatt
cgtgtggatatcgacaactggcgttgggcgggcgtgcctttctatttgcgtagcggtaaa
cgtatgccgtttaagagctctgaaattgtggtgtatttcaaaaacccaccgcataacttg
tatcgctcaagctaccgtaatctgccaccgaacaagctgactattcgtctgcaaccccat
gaaggggttgaaatccagatgatgaacaaagtgccaggtttggagcaaaaacaacgtcta
caaaccactaaactcgatttgagcttctccgataccttcaaaaatgaacgtatcgccgat
gcctacgagcgtctattactcgaagctatgctcggtaatcaagcgctgttcgtgcgccgc
gacgaagtcgagcaggcatggacttgggtggatggcattatccaatcgtgggaacaaagc
aacgaaaaaccaaaaccttatcctgcgggtacttggggtccagttgcgtcagttgctttg
atcaccaaagatggccgttcgtgggacgagtag

DBGET integrated database retrieval system