KEGG   Shewanella baltica OS185: Shew185_2474Help
Entry
Shew185_2474      CDS       T00571                                 

Definition
(GenBank) Cupin 4 family protein
  KO
K18850  50S ribosomal protein L16 3-hydroxylase [EC:1.14.11.47]
Organism
sbm  Shewanella baltica OS185
Brite
Enzymes [BR:sbm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.47  50S ribosomal protein L16 3-hydroxylase
     Shew185_2474
Ribosome biogenesis [BR:sbm03009]
 Prokaryotic Type
  ribosomal protein modification factors
   Shew185_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_4 Cupin_1 Cupin_8 Cupin_2 JmjC ARD
Motif
Other DBs
NCBI-ProteinID: ABS08611
Position
2950577..2951716
Genome map
AA seq 379 aa AA seqDB search
MYTLNLDIAQFLSEYWQKKPLLIKKAFPQFEDPISADELAGLACEEEISSRIVVTKDNDW
EVVQGPFEDYDSYGETHWQLLVQAVNHWYPDSQPLVEALRFLPDWRFDDLMASFATPSGG
VGPHVDNYDVFIIQGEGERRWTVGDNTPQQRRGGNPNSPLVEDFTPIIDVVLEKGDMLYI
PPGFPHCGETLTVAMSYSIGFRAPSQQELVSEVADYLLDNNLGQQRFTSQTEPSSAGIVS
QDHQVGIMSLLSQLSQDPNSYQIVLGKLLSQNRFELDLCEGEEAYSIEDLQDAFAQGAGV
SRIGGLKVLRLENDATPRLFINGDVHELLNTPADVIAQLSDNVSLSADEATEICQHEEVQ
ALLLKLINQGFFYLSDSED
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtatacactcaatctcgatatcgcccagtttcttagtgaatactggcaaaagaaaccc
ctgctgatcaaaaaagcctttccgcagtttgaagatcctatcagcgccgatgaactagca
ggccttgcctgtgaggaagaaatctcttcacgtatcgtcgtcaccaaagacaatgattgg
gaagtggtccaaggcccgtttgaggattacgacagctatggcgaaacccattggcaattg
ctagtgcaagcagtcaaccattggtatcccgattcacagccattagttgaagcgctgcgc
tttctacctgactggcgcttcgatgatttgatggcctcatttgcaaccccaagtggcggc
gtaggcccacacgtcgataactacgatgtgtttatcattcaaggcgaaggtgagcgtcgc
tggactgtgggcgacaatactccgcaacaacgccgcggtggcaacccaaactcgccgctg
gttgaagacttcaccccaattatcgatgtggtgctagaaaaaggcgacatgctttatatt
ccgccaggtttcccgcattgcggcgaaaccctaactgtggcaatgagttactcgattggt
tttcgcgccccaagccagcaagaattggtcagcgaagttgccgattatttgctcgacaat
aacttaggtcagcagcgtttcacctcacaaactgaaccgagttcagcgggtatcgtcagc
caagatcatcaagtgggcataatgtcactcttgagtcagctgagccaagatcccaatagc
taccaaatcgtgttaggtaagctactcagtcaaaaccgtttcgaacttgatttgtgtgaa
ggtgaagaagcttacagcattgaagatttgcaagatgccttcgcccaaggtgctggcgtc
agccgtatcggcggtttgaaagtattgcgccttgaaaatgatgccacgccgcgattattc
atcaatggtgacgtgcacgaattgctcaatacaccggcagacgttatcgcacagttgagc
gataacgtgagcttaagcgccgatgaagcaactgaaatctgtcagcatgaagaagttcaa
gccttactgttgaaactcatcaatcaaggtttcttttacttaagcgacagcgaagattaa

DBGET integrated database retrieval system