KEGG   Shewanella baltica OS185: Shew185_3683Help
Entry
Shew185_3683      CDS       T00571                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00670  One carbon pool by folate
sbm00790  Folate biosynthesis
sbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shew185_3683
   00670 One carbon pool by folate
    Shew185_3683
Enzymes [BR:sbm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Shew185_3683
    1.5.1.50  dihydromonapterin reductase
     Shew185_3683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: ABS09808
Position
complement(4378902..4379648)
Genome map
AA seq 248 aa AA seqDB search
MTSPIIITGVGKRIGYALAKHFLAQGQQVIGTYRSHYASIDELNALGATLYPCDFYGDAQ
VQALIDELTQLPQVRAIIHNASDWLPDPVLTKNEPLKSTTFTPSQVLLRMMQVHVSVPYQ
LNLALETQLRAGAGDEIGGSDVIHLTDYVAEKGSQKHIAYAASKAALHNMTLSFAAKFAP
EVKVNSIAPAMILFNTGDDAAYQQKTLAKALLPKEAGNEEIIELVDYLLNSRYVTGRCHN
VDGGRQLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcccatcataatcacaggcgtgggtaaacgcataggttacgccttagccaaa
cattttctagcccaaggtcagcaggtgattggtacttatcgcagccattacgccagtatc
gatgagctgaacgctttaggcgcgactctgtatccctgcgatttttatggcgatgcccaa
gtgcaagccttaatcgatgagttaactcaactgccccaagttcgcgccattattcacaat
gcttcggactggctgccagatcctgttcttacaaagaatgagcctttaaagagtaccact
tttacaccgagccaagtgctgctgcggatgatgcaagtgcatgtgagcgtgccctatcag
ttgaacttggccttagagacgcagctaagagctggtgctggtgatgaaatcggcggcagt
gatgtgattcatcttaccgattacgtggcagagaagggcagtcagaagcacatagcttat
gccgccagtaaagccgcgctgcacaatatgacgctatcctttgccgccaaatttgcgccc
gaggtgaaagtgaattcgattgcaccagcgatgatcctatttaatacgggtgatgacgcc
gcctatcagcaaaaaaccttagccaaagcgctgttgccgaaagaggcggggaatgaggag
attatcgaactcgtggactacctgcttaatagccgttacgtcaccggtcgttgccataat
gtcgatggcggccgccagttaaaatag

DBGET integrated database retrieval system