KEGG   Shewanella baltica OS185: Shew185_4436Help
Entry
Shew185_4436      CDS       T00571                                 

Definition
(GenBank) Type-F conjugative transfer system pilin assembly protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
sbm  Shewanella baltica OS185
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbm02044]
    Shew185_4436
Secretion system [BR:sbm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Shew185_4436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraF DUF3452 Band_7
Motif
Other DBs
NCBI-ProteinID: ABS10546
Position
pS18501:complement(56110..56985)
Genome map
AA seq 291 aa AA seqDB search
MRTLLNDRLQHAAVSPFFRWSSHAPLAWLSTKKGDAVVNKRSALVLLMLTTFCLGANATD
AQGWRWYNEPTAPKKQALKKAETPSVTLTRTQTLTPTEQMDWFHSYYQDTLNDAAINSQD
SKKVERAMLLNQYVSNKSSEFGMTFKKVLLDNPELSYTKDRPTEQAARSTYLSLERNKKM
RAVRSLADAGWGLFFVYKGQEEIDIALAPSVQQFATEHGIELLGVTLDGVALPAIVQNRQ
NDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRFLNVATDFAPDF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaggacgttgttaaatgaccgcttacaacatgccgcagtatctcctttttttcggtgg
tcaagccacgcgccgttggcgtggttgtccacaaaaaaaggggatgcggtggtcaacaag
cgcagcgcgttagtgctccttatgctgacaacgttttgcctcggcgcaaacgcaacggat
gcacaaggctggcgctggtataacgaaccgaccgcccccaagaagcaagcacttaaaaag
gccgaaacgccaagcgtcacacttacccgaacgcaaacgctgaccccgacagagcagatg
gattggtttcacagctactaccaagacacgctcaatgacgcggcgataaacagccaagac
agcaagaaagtggaaagggcaatgctgcttaatcagtacgtcagcaataaatcctcagag
ttcggcatgacctttaaaaaggtcctgctagataaccctgagctgtcttacaccaaagat
agaccgacggaacaagcggcaagaagcacctatttatcattagagcgcaacaagaagatg
cgcgcagtacgcagccttgccgatgcgggatgggggctgttctttgtctacaaaggccaa
gaagaaattgatattgcgctagcgcccagcgtgcagcagttcgctactgagcatggcatt
gagctactgggcgtcacgctcgatggtgtagcactgccagccatcgtgcagaaccgccaa
aacgaccagcacataaacgtcccgtttagtcccgcactcgtgttagttaatcctggcacg
ggggaaatgaaaccgctcgcgtatggctttatctctcaagacgatttactgggccgcttc
ctgaacgtggccaccgatttcgcccctgacttttaa

DBGET integrated database retrieval system