KEGG   Shewanella baltica OS195: Sbal195_0360Help
Entry
Sbal195_0360      CDS       T00622                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00230  Purine metabolism
sbn01100  Metabolic pathways
Module
sbn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sbal195_0360
Enzymes [BR:sbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sbal195_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_16 RsgA_GTPase AAA_33 AAA_29 AAA_22 ABC_tran cobW
Motif
Other DBs
NCBI-ProteinID: ABX47541
UniProt: A9KXX6
Position
complement(408191..408823)
Genome map
AA seq 210 aa AA seqDB search
MTARGNLFIVSAPSGAGKSSLISALLKDKPADMQVSVSHTTRAPRPGEVDGQHYHFVNVE
QFKALIAENAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLDIDWQGAEQVKAVMPDAVG
VFILPPSKAELERRLTGRGQDSSDVIASRMAQAVSEMSHYKEYDFIIVNDDFDTALADLR
AIIRSQRLTCASQIHAQNDMLNDLLAGQLS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcggaaatttatttattgtgtcggcgccaagtggcgcaggtaaatcctcg
ctgatctcggccttgcttaaagacaagcccgctgacatgcaggtttcggtatcacatacc
acccgcgcgccacgcccaggtgaagtcgatggtcaacactatcacttcgttaatgttgaa
caattcaaagcgttaattgctgaaaatgccttttttgaatgggcagaagtgttcggcaat
tactatggtacctcgcgccatgtgattgagcatacgctcacccaaggtatcgatgttttc
ctcgatatcgactggcaaggtgccgagcaagttaaagctgtgatgcccgatgccgttggt
gtgtttattctgccaccctcgaaagccgagctagaacgccgcctcactggccgtggacaa
gacagtagcgatgtgatcgccagccgtatggcacaagccgtatcggaaatgtcccactat
aaagaatatgattttattatcgtcaacgacgattttgacactgcgttagctgatttgcgt
gccatcattcgcagtcagcgcttaacctgtgctagtcagatccacgcgcaaaatgatatg
cttaacgatctgttggcaggccaactgtcatag

DBGET integrated database retrieval system