KEGG   Shewanella baltica OS195: Sbal195_1343Help
Entry
Sbal195_1343      CDS       T00622                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00620  Pyruvate metabolism
sbn00630  Glyoxylate and dicarboxylate metabolism
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01120  Microbial metabolism in diverse environments
sbn01200  Carbon metabolism
Module
sbn_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal195_1343
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal195_1343
Enzymes [BR:sbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal195_1343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABX48518
UniProt: A9KTH7
Position
1598595..1600244
Genome map
AA seq 549 aa AA seqDB search
MTEHTLSEQQLNSTLGKATANATLNIVGRDIPGQEVIFTEGAVALLESLCREFADEVPAL
LAKRKDKQARIDKGSLPDFLPETRAIRDGAWQIRGIPDDLLDRRVEITGPVERKMVINAL
NANAKVFMADFEDSLAPSWEKVVEGQINLRDAVRGDIEYTAPDTGKHYKLGPNPAVLICR
VRGLHLKEKHVQFNGKAIPGSLFDFALYFYHNYRQLLAKGSGPYFYIPKLESHVEARWWA
KVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKT
LKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPVQNEAVL
QRVRRDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGQDHCNQLHITRDVDAPILASEL
LKTCDGERTEQGMRLNIRIALQYLEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHG
KSLSNGKLVTKQLFKDMLVEELSNVKKEVGSDRFTHGKFTQAVVLLEDITTSDELVDFLT
LPGYEMLTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacactttgagtgaacagcaattgaattcgacactgggtaaagctacagca
aacgccacgcttaatattgtgggtcgtgacattccaggccaagaagtcatctttaccgaa
ggggctgtcgccttactcgaatccctttgtcgtgagtttgccgacgaagtaccagcctta
ctcgctaaacgtaaagataagcaagcgcgtatcgataaaggatcattacccgactttctg
cctgaaacccgcgctattcgtgatggtgcatggcaaattcgcggtattcccgatgacttg
cttgaccgccgtgtagaaatcacaggtcccgttgaacgtaagatggtgattaacgcactc
aacgccaatgccaaagtgtttatggccgatttcgaagattccttagcaccaagctgggaa
aaagtcgtcgaaggtcaaatcaatctacgtgatgccgtgcgtggtgatattgagtacaca
gcaccggatacaggtaagcactacaaattaggaccaaatccggcagtgcttatttgccgc
gttcgtggtctgcaccttaaagaaaaacacgtgcagtttaatggcaaagcgattcctggc
tcactgtttgatttcgcactgtatttctaccacaactatcgccaacttttggccaagggt
agcggtccatacttttatatccctaagttagaaagtcatgttgaagcgcgctggtgggca
aaagtatttgcttttgttgaggaaaggttttgtctgcaagcgggcacgattaaatgtact
tgcctgatcgagacgttaccggccgtgttcgaaatggacgaaatcctctacgagctgcgt
tccaatatcgtcgcgctgaactgtggtcgctgggattacatcttcagctatatcaaaaca
ttaaagcgtcatagcgaccgtgttttaccggatcgccaagccgtcactatggatacgcct
ttcttaagcgcttattcaagactcttgattaagacctgccacaaacgcggtgcgttagct
atgggcggtatggcggcctttattccagccaaagatccggttcagaacgaagcggtattg
cagcgagttcgtcgagataaagaactagaggcgcgtaacggccacgatggcacttgggtg
gcgcacccaggtcttgccgataccgctatggggattttcaacgaatacataggccaagat
cactgtaatcaattacatattacccgtgatgtagacgcgccaattctggctagcgaactg
cttaaaacctgcgacggtgagcgcactgaacaggggatgcgcctgaacattcgtatcgca
ctgcagtatttagaggcgtggatcagcggcaacggttgcgtacctatttacggcttaatg
gaagatgcggcgacggctgagatttctagagcctcaatttggcaatggatccaacacggt
aagtcgttatcaaacggcaaactcgtgaccaagcaactctttaaagacatgttggttgaa
gagctgtcgaacgtgaaaaaagaagtgggtagcgacagattcacccatggcaaattcacc
caagcggtggtattgctcgaagacattaccacctccgacgagctggtcgatttcttaacc
ttacccggttacgaaatgctgactgcctag

DBGET integrated database retrieval system