KEGG   Shewanella baltica OS195: Sbal195_1525Help
Entry
Sbal195_1525      CDS       T00622                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00071  Fatty acid degradation
sbn00072  Synthesis and degradation of ketone bodies
sbn00280  Valine, leucine and isoleucine degradation
sbn00310  Lysine degradation
sbn00362  Benzoate degradation
sbn00380  Tryptophan metabolism
sbn00620  Pyruvate metabolism
sbn00630  Glyoxylate and dicarboxylate metabolism
sbn00640  Propanoate metabolism
sbn00650  Butanoate metabolism
sbn00900  Terpenoid backbone biosynthesis
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01120  Microbial metabolism in diverse environments
sbn01130  Biosynthesis of antibiotics
sbn01200  Carbon metabolism
sbn01212  Fatty acid metabolism
sbn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal195_1525
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal195_1525
   00640 Propanoate metabolism
    Sbal195_1525
   00650 Butanoate metabolism
    Sbal195_1525
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sbal195_1525
   00072 Synthesis and degradation of ketone bodies
    Sbal195_1525
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sbal195_1525
   00310 Lysine degradation
    Sbal195_1525
   00380 Tryptophan metabolism
    Sbal195_1525
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sbal195_1525
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sbal195_1525
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sbal195_1525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbn04147]
    Sbal195_1525
Enzymes [BR:sbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sbal195_1525
Exosome [BR:sbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal195_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABX48698
UniProt: A9KVF8
Position
1836741..1837931
Genome map
AA seq 396 aa AA seqDB search
MSTEQLNQDIVIVAAKRTPMGGFQGNLSSVASPMLAATAIKGLLAETQLAGEHVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARGGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKAEITPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAF
TKDGTITAANSSSISDGAAALMLTSRGEADRLGLTVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLANVGWSTDEVDLFEINEAFAMVTMLAVSELGLDIAKVNVNGGACALGHPIGCSGS
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacagttaaatcaagatatcgttatcgttgccgctaaacgcaccccaatg
ggcgggtttcaaggcaacttgtcatccgtagcatcacccatgttagctgcgacggccatt
aaaggcttgttagcggaaacacaattggcgggtgagcatgttgatgaagtcttgatgggc
tgcgtattacccgcaggcttaggtcaagcgcctgcgcgtcaggcaactttgggtgcggga
ttacccttatccgttggtgcgaccacagtgaacaaggtctgtggctcaggcatgaagacg
gtaatgttagcccacgatttgattaaagcgggcagtgcaaaagtggtgattgcaggcggt
atggaaagcatgagccaagcgccgtatttactcgataaagcccgcggcggcatgcgcatg
ggtcatggcaaagtgttagatcacatgtttttagatggtcttgaagatgcctacacgggt
ggtgctatgggaacgtttgcccagaaaacggccgatgaatttggtatcacccgcgagcag
atggacgcttttgccctaagctcgctcgaaaaagccaatgccgcgattaactcgggtgcc
tttaaagccgaaatcacgcccgttactgtcagtgatcgtcgcggtgatgtgactatcgat
accgacgagcaacccggtaatgcccgccctgaaaaaattcctacactgcgcccagccttt
accaaagatggcactatcacagcggcaaactctagctcgatttccgatggcgcagcggca
ttaatgctgacctcgcgcggcgaagctgaccgtttaggcttaactgtattagcgactatt
aaaggccacacgactcacgcccaagagccttcattgttcaccactgcaccggttggcgcc
atggcgaaattgctggctaatgtcggttggtcaacggatgaggtggatttattcgaaatc
aacgaagcctttgccatggtgactatgcttgctgtgtctgaacttggtttagatatcgct
aaggttaacgttaatggcggcgcctgtgccctaggtcatccgattggctgctcgggttca
cgtttgctggtgaccttaattcatgctttaaaagcccgtggccttaaacgcggtgttgcc
tcgctgtgtatcggcggcggtgaagcgacggcgatggccatcgaggtctaa

DBGET integrated database retrieval system