KEGG   Shewanella baltica OS195: Sbal195_2688Help
Entry
Sbal195_2688      CDS       T00622                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
sbn  Shewanella baltica OS195
Pathway
sbn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sbal195_2688
DNA repair and recombination proteins [BR:sbn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Sbal195_2688
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sbal195_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH Nop10p
Motif
Other DBs
NCBI-ProteinID: ABX49856
UniProt: A9L594
Position
complement(3193593..3194192)
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLDELIQSLRCLPGVGPKSAQRMAFQLLERDRKAGLKLASALSSAMSDVGHCQSC
RTYTEETLCPICASHKRGTSSTICVVETPADVLAIEAGGHFTGRYFVLLGHLSPLDGVGP
EELGLALLERHLASGDVAELILATNPTVEGEATAHFIADMARRHKVMISRIAHGVPVGGE
LEYVDSTTLALSFNGRLPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtccactgttagatgagttaattcagtccctgcgttgtttacctggggtt
gggcctaaatcggcgcaacgtatggcgtttcagttactcgagcgcgacagaaaagcaggg
cttaaattagccagtgcgctgtccagtgcgatgagtgacgtcggtcattgtcagtcttgc
cgaacctacactgaagaaaccctctgtccgatttgtgctagccataaacgcggcacgtct
tccaccatttgtgtggtggaaacgccggccgatgtgttagccattgaggcgggtggacat
ttcaccggtcgctactttgttcttttaggtcatttatcgccactcgatggtgttgggcca
gaagagttaggtttagcgttacttgagcgccacttggcctcgggtgatgtggccgagttg
attctggcgaccaatccgacggtagaaggcgaggcaacagcgcattttattgctgatatg
gccagacgccataaggtgatgatcagtcgcatcgcccacggcgtgcccgttggtggcgag
cttgaatatgtggatagcacgacgttagccttgtcattcaatggccgtttaccgctttaa

DBGET integrated database retrieval system