KEGG   Shewanella baltica OS195: Sbal195_2758Help
Entry
Sbal195_2758      CDS       T00622                                 

Definition
(GenBank) DNA ligase, NAD-dependent
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn03030  DNA replication
sbn03410  Base excision repair
sbn03420  Nucleotide excision repair
sbn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Sbal195_2758
   03410 Base excision repair
    Sbal195_2758
   03420 Nucleotide excision repair
    Sbal195_2758
   03430 Mismatch repair
    Sbal195_2758
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbn03032]
    Sbal195_2758
   03400 DNA repair and recombination proteins [BR:sbn03400]
    Sbal195_2758
Enzymes [BR:sbn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     Sbal195_2758
DNA replication proteins [BR:sbn03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     Sbal195_2758
DNA repair and recombination proteins [BR:sbn03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     Sbal195_2758
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Sbal195_2758
   MMR (mismatch excision repair)
    DNA ligase
     Sbal195_2758
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sbal195_2758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT DNA_ligase_ZBD HHH_5 PTCB-BRCT HHH
Motif
Other DBs
NCBI-ProteinID: ABX49925
UniProt: A9L5Z1
Position
complement(3278596..3280653)
Genome map
AA seq 685 aa AA seqDB search
MQDIQLDTLLSEDVTPENASQVMQALSQSLNEHNIRYYVDDAPSITDSEYDRLMQRLLKL
EALYPHLIVADSPTQRVGGLALAKFDQITHLKPMLSLDNAFDEADFSAFHKRVTDKVGEV
SFCCEPKLDGLAVSILYRHGVLERAATRGDGSVGEDITENVKTIKSIPLKLRGNDFPELV
EVRGEAFMPKAAFEALNDRARAKDEKLFVNPRNAAAGSLRQLDSKITAARSLAFYAYALG
VVEPDSHPLAKTHFEQLQQLKSWGLPISSEIKVCAELSQVYDYYKDILTRRSDLAFEIDG
VVMKVNDIAQQQRLGFVAKSPRWAIAYKFPAQEEMTLLEGVDFQVGRTGAVTPVARLKPV
FVGGVTVSNATLHNADEIARLGIKVGDTVIIRRAGDVIPQIVAIVPERRPETATDIVFPH
NCPVCGSLVERLEGEAVARCSGGLFCEAQRKEAIKHFASRKALDIDGMGDKVVEQLIDKE
LVQSPADLFKLTASMMTMLDRMGMKSATNLAAAIEAAKTTTLARFLYALGIREVGEATAA
NLAAHFASLDALRVATVEQLTEVEDVGAVVAQHVAHFFAQPHNLEVIDALIAAGVHWPAI
EAPSADAQPLKGQTWVLTGTLNQLNRNDAKAQLQALGAKVAGSVSKNTDCLVAGEAAGSK
LAKAQELGVKVMDEDELLALLAANA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacattcaactcgatacacttctgtctgaagacgttaccccagaaaacgcatcg
caggtgatgcaggcgctcagccaatcactgaacgagcacaacattcgttactatgtggat
gatgcgccgagcattaccgattctgagtacgacaggttgatgcagcgtttactcaagctt
gaggcgttatacccccatttgattgtggctgattcaccgactcaaagggtgggcggattg
gcgctcgccaagtttgatcagatcactcatcttaagcctatgttaagtctggataacgcc
ttcgatgaggctgatttcagtgctttccacaaacgtgtcacggataaagtcggtgaggtg
agtttttgctgcgagcctaaacttgatggccttgccgtgagtatcttgtatcgccatggc
gtgcttgagcgcgctgcgacccgcggcgatggttcagtgggtgaagacatcactgaaaac
gttaaaaccattaaatcgataccgcttaaattgcgcggtaatgatttccctgaactcgtt
gaagtgcgcggcgaagcctttatgcctaaagccgcctttgaagcgctgaacgacagggcg
cgcgccaaggatgaaaagctctttgttaatccgcgtaacgctgctgccggcagcttgcga
caactcgacagtaaaattaccgccgcccgctcattggctttttatgcctatgcgctaggg
gttgttgagccagattcccatccgttagctaaaacccatttcgagcagttacagcagctt
aaatcgtggggcttacccattagtagcgaaatcaaagtctgcgctgaattaagccaagtc
tatgactactataaggacattcttactcgtcgcagcgatttagcgtttgaaatcgatggc
gtagtgatgaaagttaacgatattgcccagcagcaacgtttaggttttgtggctaaatct
ccccgctgggcgattgcctataaattccccgcacaggaagaaatgactttgctcgaaggg
gttgatttccaagtgggccgcacaggtgccgtgacgccagtcgcgcgcttaaagccagta
tttgttggtggcgtgacggtatcgaatgcgacgctgcacaatgccgatgaaattgcccgc
ttaggcattaaagtcggtgacactgtgatcatccgccgcgctggcgatgtgatcccacaa
attgttgccatagtgccagaaagacgtcctgaaacggcgactgacattgtatttccgcat
aattgccctgtgtgtggcagtttagtcgagcgtctcgaaggtgaggcagtggcgcgctgt
agcggtggtttattctgcgaagcgcagcgtaaagaagcgattaagcatttcgcatcccgc
aaggctttggatatcgatggcatgggcgacaaagtcgtcgagcaattgattgataaagaa
ctcgtccaaagtcctgcggatctgtttaagctcaccgcctctatgatgactatgctcgac
cgcatggggatgaagtcggcaaccaatttagcagcggcgattgaagcggccaaaaccaca
acacttgcgcgtttcttatatgccttgggcattcgcgaagtgggcgaggcgacagcggca
aaccttgcggcgcactttgctagtttagatgcgctgcgggtggcaactgtggagcagtta
actgaagtggaagatgttggcgccgtggtggcccaacatgtggcccacttttttgctcag
ccgcataaccttgaggttatcgatgccttaatcgccgctggtgtgcattggccggccatt
gaagcgccaagtgctgatgcacagccgcttaaaggccaaacctgggtattgaccgggacc
ttaaatcaactcaatcgtaacgatgctaaagcgcagctgcaggcgctgggggcaaaagtt
gctggcagtgtgtcgaaaaataccgattgcttagtggcaggtgaggcggcaggttcaaaa
ctcgctaaagcgcaggagcttggcgttaaagtgatggatgaggatgagttattggcactc
ctcgccgcgaacgcttga

DBGET integrated database retrieval system