KEGG   Shewanella baltica OS195: Sbal195_4089
Entry
Sbal195_4089      CDS       T00622                                 

Definition
(GenBank) Diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00300  Lysine biosynthesis
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01120  Microbial metabolism in diverse environments
sbn01230  Biosynthesis of amino acids
Module
sbn_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Sbal195_4089
Enzymes [BR:sbn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     Sbal195_4089
SSDB
Motif
Pfam: DAP_epimerase PhzC-PhzF
Other DBs
NCBI-ProteinID: ABX51249
UniProt: A9L5F5
Position
complement(4821891..4822718)
AA seq 275 aa
MIQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFH
YRIFNADGTEVEQCGNGARCFARFVRNKGLTNKSKIRVSTSSGKMTLRLERDGTVTVNMG
VPILEPSQIPFKAKKPEKTYLLQTPMQTFLCGAASMGNPHCVLDVEDVASASVAEIGAML
TKHERFPRGVNVGFMQVVDSGHIKLRVYERGAAETLACGTGACAAVVVGQVQGKLGQQVR
VDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL
NT seq 828 nt   +upstreamnt  +downstreamnt
ttgatccaattcactaagatgcacggactgggcaacgattttatggtggtcgatggggtc
acgcagaacgtgttcttttcgcctgagcagatccgccgtttagccgaccgtaactttggt
ataggtttcgaccaactactcttagttgagccgccttatgatcccgatttagattttcat
tatcgcatcttcaatgccgatggcactgaagtagaacaatgcggtaatggcgcccgctgt
ttcgcccgttttgtgcgtaataaaggcctgactaacaagagcaaaatccgtgtcagcacc
tcatcgggcaagatgactctgcgcttagagcgagacggtactgttaccgtaaatatgggc
gtgccgatcctcgaaccgagtcagatccccttcaaagccaagaaacctgaaaaaacctat
ttactgcaaacaccgatgcaaacctttttgtgtggcgcggcttctatgggtaatccccat
tgcgtgctcgacgttgaagatgtggcgagcgcttctgtcgctgaaattggtgccatgctc
actaagcatgagcgttttccacgcggtgtgaatgtgggatttatgcaggtcgtagactcc
ggccacattaagctgcgggtgtatgagcgcggcgcggccgagaccttggcctgtggcaca
ggcgcatgtgcagctgtagttgtaggtcaagtgcaaggaaagctcggccagcaagtgcgg
gtggatttacccggcggcaccttaaccatcaactgggaaggcgagggtaaacctttgtgg
atgacgggccctgcgcagcacgtttacgatggacaaattcagttatga

DBGET integrated database retrieval system