KEGG   Shewanella baltica OS195: Sbal195_4214Help
Entry
Sbal195_4214      CDS       T00622                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00620  Pyruvate metabolism
sbn00680  Methane metabolism
sbn01100  Metabolic pathways
sbn01120  Microbial metabolism in diverse environments
sbn01200  Carbon metabolism
Module
sbn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal195_4214
  09102 Energy metabolism
   00680 Methane metabolism
    Sbal195_4214
Enzymes [BR:sbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sbal195_4214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3666
Motif
Other DBs
NCBI-ProteinID: ABX51372
UniProt: A9KTZ1
Position
4980563..4983232
Genome map
AA seq 889 aa AA seqDB search
MVVTKADNMTDMYASLRSNVSMLGQILGDTMRTHLGDSFLEKVEQIRKLAKDSRRGDQAA
REQMLELLTALPDEELVPFAKAFNQFLNLANLSEQFHTISRNCDELVCVPDPVEQLLGRM
LNGRVDQTKMLDCLKTLDIDLVLTAHPTEISRRTLIQKYAAIVDCLTEQENDQLSDRERQ
QISLRLRQLIAQIWHTNEIRRERPTPVDEARWGLSTIEESLWHAVPDFLRQLNDQVQQRT
GQQLPIDIAPVRFSSWMGGDRDGNPFVTAKVTQEVLDRNRHAAARLFLEDIVLLVGELSM
EEANDELKAYTNNSCEPYRHVLRSIRQRLRDTIDYLNARIEGHNPEVDKSSLIWQESDLK
APLEMLYKSLTDCGMRLIANGLLLDILRRLACFGIHMLRLDIRQDASRHSDVLAELTRYL
GMGDFNHWDETEKQAFLLRELSNRRPLIPSNWQPSADVAEVLNTCRLIAKHPAKALGSYV
ISMAGKPSDVLTVLLLLKETGCSHPMRVVPLFETLSDLNNAAACITDLLDIDWYRGYTKG
MQEVMIGYSDSAKDAGVMAAAWAQYHAQEQLVAVCKQAGVKLTLFHGRGGSIGRGGGPAH
KAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVLEATLLPPPEPKQEW
RDCMQRIAEESVGAYRGIVRDEPDFVAYFRAATPEVELGKLPLGSRPAKRRVDGGIESLR
AIPWIFAWSQNRLMLPAWLGAGEALQAACERREMGLLQEMEREWPFFSTRISMLEMVYAK
AEPNLARYYETCLVPKDLHHLGETLRQRLDLGIKVVLELTKSDSLMAHTPWNRESVKLRN
PYIDPLNFLQTELLARTRKETTETPASEHVQLALMLTIAGVAAGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaaccaaggcagacaatatgaccgatatgtatgcgtcattaagatcgaacgtg
agtatgttaggacaaatcctcggtgacactatgcgcacccacctcggggactcttttctc
gagaaggttgaacagatccgtaaacttgctaaagattcacgccggggcgatcaagctgct
agagagcaaatgctcgagttactcaccgccctgccagacgaagaattagttccgtttgca
aaggcatttaaccagttcctcaacctagctaatttatctgaacaatttcataccattagc
cgcaactgtgacgaactcgtctgcgtgcctgatcccgtggaacaactccttgggcgcatg
ttaaatggccgtgtagaccaaacgaaaatgctcgactgccttaagacactggatatcgat
ctagtgctgacagcgcaccccacagaaatttcccgtcgcaccttgatccaaaagtacgcc
gccattgtcgactgcttaactgaacaagaaaacgaccaattatcagatagagaacgtcag
caaattagtctgcgcctgcgccaattgatcgcgcaaatctggcacaccaatgagatccgc
cgtgagcgcccaacacctgttgatgaagcccgctggggattatcaaccattgaagagtca
ctctggcatgcggtgccagacttcttaagacagcttaacgaccaagtgcagcaacgcacg
ggtcaacaattaccgattgatatcgcgccagtgcgtttttcaagctggatgggcggcgat
cgcgacggcaacccctttgttaccgcgaaggtcacccaagaggtgctcgatcgcaaccgc
catgccgccgccagattatttctagaagacatagtcctattggttggcgagctgtcgatg
gaagaagccaatgatgagttaaaggcttacaccaacaacagctgcgagccataccgccac
gtgttgcgatctattcgtcaaagactgcgtgacaccatcgattatttaaatgcgcgcatc
gaaggccacaatcctgaagtcgataagtcgagcctgatttggcaagaaagcgatctcaaa
gcgccgttagaaatgctttataagagtttgaccgactgcggtatgcgcttaatcgccaac
ggtctattacttgatattctccgtcgtctcgcctgttttggcattcacatgctcagactc
gacattcgccaagacgccagtcgtcacagcgatgtgctcgccgaattaactcgctatctc
ggcatgggtgatttcaaccattgggatgaaaccgagaaacaagctttcctattacgcgaa
ctcagcaaccgtcgtccgctgatcccaagtaactggcagccgtcagccgatgtggccgaa
gtgcttaatacctgtcgtttgatcgctaaacatccagctaaggcacttggatcctatgta
atttcgatggcgggtaagccatcggatgtcttaacggttttactgttactcaaagaaacg
ggctgttcgcacccaatgcgcgtagtgccgctgtttgaaaccctaagcgacttaaacaac
gccgcagcatgtattaccgatttactcgacatcgactggtatcgtggttataccaagggc
atgcaagaagtgatgattggctactctgactctgctaaagatgccggcgtaatggcggcg
gcttgggctcagtatcacgctcaagagcagttagtggctgtctgtaaacaagcgggcgtc
aagctcacactattccatggccgcggcggcagcattggtcgcgggggcggtcctgcacac
aaagcgattctatcccaacctccggggtcggtagatggccgtattcgtgtcactgagcag
ggcgaaatgatccgcttcaagtttggcttgccaaaactcgcggttcaaagcttagccttg
tatacctctgccgtattggaagcgaccctactaccaccgccagaacctaaacaagaatgg
cgcgattgcatgcaacgtatcgctgaagaatccgtgggtgcataccgtggcatagtgcgt
gatgaacctgattttgtggcttatttccgcgcggcaacgccagaggtggaattaggcaaa
ctgccactcggcagccgcccagctaaacgtcgtgtcgatggtgggattgaaagcctacga
gctattccgtggatttttgcttggtcgcaaaaccgtttgatgttacctgcatggcttggc
gccggtgaagcgctacaagccgcctgtgaacgccgtgaaatgggcttattacaagagatg
gaacgggaatggcctttcttcagcactcgcatttcaatgctggaaatggtctacgccaag
gcagaacctaatttggcccgctactatgaaacctgtttagtaccaaaagacttacatcac
ttaggcgaaaccttgcgccaacgcttagatctgggcattaaagtcgtgcttgaactgaca
aaatcagatagcttaatggcgcatacgccgtggaatcgcgagtcagtaaaactgcgaaat
ccgtatatcgatccattaaacttcttacaaactgagctattagcgcggacacgtaaggaa
acaaccgaaactcccgcgtctgaacatgtgcagctagcgctaatgctgactattgcaggt
gtggcagcgggaatgagaaacactggttaa

DBGET integrated database retrieval system