KEGG   Shewanella baltica OS195: Sbal195_4529
Entry
Sbal195_4529      CDS       T00622                                 
Name
(GenBank) type-F conjugative transfer system pilin assembly protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
sbn  Shewanella baltica OS195
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbn02044]
    Sbal195_4529
Secretion system [BR:sbn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sbal195_4529
SSDB
Motif
Pfam: TraF DUF3452 Band_7
Other DBs
NCBI-ProteinID: ABX51686
UniProt: A9L6A4
Position
pS19501:complement(5401..6276)
AA seq 291 aa
MRTLLNNRLQHAAASPFFRWSSRAPLAWLSTKNGDAVVNKRSALVLLMLTTFCHGANATD
AQGWRWYNEPTAPKKQAPKKAETPSVTLTRTKTLTPTEQMDWFHSYYQDTLNDAAINSQD
SEKVEKAMLLNQYVSNKSSEFGMTFKKVLLDNPELSYTKDRPTEQAARSTYLSLERNKKM
RAVRSLADAGWGLFFVYKGQEEIDIALAPSVQQFATEHGIELLGVTLDGVALPAIVQNRQ
NDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRFLNVATDFAPDF
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaggacgttgttaaataaccgcttacaacatgccgcagcatctcctttttttcggtgg
tcaagccgcgcgccgttggcgtggttgtccacaaaaaatggggatgcagtggtcaacaag
cgcagcgcgttagtgctccttatgctgacaacgttttgccacggtgcaaacgccacggat
gcacaagggtggcgctggtataacgaaccgacagcccccaagaagcaagcgcctaaaaag
gccgaaacgccaagcgtcacactcacgcgcaccaaaacgctgacgcccaccgagcagatg
gattggttccacagctactaccaagacacgctcaatgacgcggcgataaacagccaagac
agcgagaaagtggaaaaggccatgctgcttaatcagtacgtcagtaataaatcgtcagag
tttggcatgaccttcaaaaaggtcctgctggataaccctgagctgtcttacaccaaagac
aggccaacagagcaagcggcaagaagcacctatttatcattagagcgcaacaagaagatg
cgcgcggtacgcagccttgccgatgcgggatgggggctgttctttgtctacaaaggccaa
gaagaaattgatattgcgctagcgcccagcgtgcagcagttcgctacagagcatggcatt
gagctacttggcgtcacgctcgatggtgtcgcactgccagccatcgtgcagaaccgtcaa
aacgaccagcacataaacgtcccgtttagtcccgcactcgtgttagttaatcctggcacg
ggggaaatgaaaccgctcgcttatggctttatctctcaagacgatttacttggccgcttc
ctgaacgtggccaccgatttcgcccctgacttttaa

DBGET integrated database retrieval system