KEGG   Shewanella baltica OS195: Sbal195_4535
Entry
Sbal195_4535      CDS       T00622                                 
Name
(GenBank) type-IV secretion system protein TraC
  KO
K12063  conjugal transfer ATP-binding protein TraC
Organism
sbn  Shewanella baltica OS195
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbn02044]
    Sbal195_4535
Secretion system [BR:sbn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sbal195_4535
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF5934 AAA_10 TrwB_AAD_bind DUF87 Pox_A32 ABC_tran AAA_30 APS_kinase AAA_29 FtsK_SpoIIIE PRK
Other DBs
NCBI-ProteinID: ABX51692
UniProt: A9L6B0
Position
pS19501:complement(10924..13512)
AA seq 862 aa
MKQRIKDDLGALYASSKQQHNHLHHELPYRIYDDAEQVFENANTLGFGFAISLFGGANDD
LIKTMNALVCTLPEGDKWHYQFVMVGNNQVGELIEQNQALLSGRNAICDKFANNEAIYAK
HSSTKGFGTKLSSAYHYDLKNTKGFFFVSTTEDMPALLDMRLGVESELAQTGMHIRRLGA
DDLIEHCREHLNFSHQQDRVTPAKYNEYQPLNTQILSPDSEFIINRDSVNIRHTPMQSDN
SVDTTLINLGLKGLPNDFRLYAFPNCIASLSYTMNSVQCPYRVSVSFYINKTGEQTTRND
SKIGSLTKTVNSPMRLLIPSAADELAERKEIQKGLSSHAFKITTMTLNVTLYTTEEKHRH
DTSKAIATFRTAGIDLIRNNKLQGMCTLSTLPFSMSEGFMKDSQKAGLCFMMKTSNLVNF
LPIVADYKRLSAGLLLPTMRHQISYFDPFNCGSDNYNMAITGGSGAGKSFFMQALVKSIF
AKGGKAWILDKGQSYKKLTQTLGGVYLDSSQIFLNPFTHLGKVLSVRDAGTFGPILDDEG
QAIDPITEVLGNITALIATMASPDEKLTGFQTALLGDAILLAWQKCGNDTLIDDVQKALY
DIAAQKNDDTRISDIAAQLNKFCSSGIHGAIFNKPSMLDPNIDITTLELDGFKGELQRPV
IFALMVTISQQMYLSGQRSIPKICVIEEAWSLMSGANAQSKDFINEGYRTVRKFGGSFAT
VTQGMNDFFANAEAEAALNSSDIHITLRQGDGFGDFLNKHPDHFSPFEQHMIKSFPRAND
AGHSCVMLKAGGLVSFHRIFADPWSRAMLSTEPKEFEHCENLIKGGMPLLDAIELTAQHF
YPDDMARFDAILSAAATHKEAA
NT seq 2589 nt   +upstreamnt  +downstreamnt
atgaaacaacgtattaaagacgatctcggcgcactctatgccagcagcaaacagcagcac
aaccatctgcatcatgaattgccctatcgcatttatgatgatgccgaacaagtatttgaa
aatgccaatacgcttggttttggctttgccatttcgctgtttggcggggctaatgacgac
ttgatcaaaaccatgaacgccttggtgtgcacactgccagagggcgacaaatggcactat
caattcgtcatggtgggtaacaaccaagtcggtgaactcatcgagcaaaatcaagcgctg
ctcagtggtcgcaatgccatttgcgataaatttgctaataatgaagctatctatgccaaa
cacagttcgaccaaaggctttggcaccaagctcagcagcgcataccactacgatttaaag
aacaccaaagggtttttctttgtttcaaccacagaggacatgcctgcactgctggatatg
cgtcttggcgttgagtcagaactggcgcaaacaggcatgcacattcgccgcttaggcgct
gacgatctgattgagcattgccgcgaacacttaaatttttcgcatcaacaagatcgcgtc
acgcccgctaaatataacgagtatcaacctctcaacacccaaattctcagccctgacagt
gagttcatcattaatcgtgattcggtcaatatccgtcacacaccgatgcaatccgacaac
agtgtcgataccaccctaatcaatctagggcttaaagggctgccgaacgactttaggcta
tatgcgtttcccaactgtattgcatcactcagttacaccatgaacagtgttcaatgccct
taccgtgtcagcgtgtcgttttatattaataaaacgggtgagcaaacaacccgtaacgac
agcaaaattggctcactaaccaaaacggtcaactcccctatgcggttgttgatccccagt
gccgcggatgaactggctgaacgcaaggagatacaaaaaggactcagctcacacgccttt
aaaatcaccaccatgacattgaatgtcaccctgtatacgacagaagagaagcaccgccac
gacacctcaaaggcgattgcgacatttcgcacggcaggcattgatttaatccgaaacaat
aaactgcaaggcatgtgcacactgtccaccctcccgttctcaatgagcgaaggctttatg
aaagacagccaaaaagcgggcctgtgtttcatgatgaaaacctcaaacttggtgaatttc
ttaccgattgttgcagactacaaacgcttatcagcagggttactcttgccaacaatgcgc
catcaaattagctatttcgatccgtttaactgcggcagtgataactacaacatggcgatt
acgggcggctcaggggcagggaagtcattcttcatgcaagccttagtaaaatcgattttt
gccaaagggggcaaggcatggattcttgacaagggtcagagttacaaaaaactcactcaa
acattaggcggcgtctatctcgacagttcgcagattttcctaaacccgtttacccactta
ggcaaagttttaagcgtgcgggatgcgggtacttttggcccaatcctcgatgatgaaggt
caagccattgatcccatcaccgaagtgttgggaaacatcaccgcgcttatcgccaccatg
gcatcacctgatgaaaagctcaccggatttcagacggcattactcggcgatgctattttg
ctggcatggcaaaaatgcggtaacgacacgctgattgacgatgtgcaaaaggcactctat
gacattgccgcgcaaaaaaatgacgatacccgtatcagtgatatcgctgcgcaattaaac
aagttctgttcaagcggtattcatggcgcgattttcaataagccctcgatgctcgatccc
aatatcgatatcaccacgcttgaactcgatggatttaaaggcgagctacaacgtccagtg
attttcgcgttaatggtgacgattagccaacaaatgtacttatcgggccaacgttctatt
ccgaaaatctgtgtgattgaagaagcgtggtcgctcatgagcggcgcgaatgcgcaaagt
aaggatttcatcaacgaaggttatcgcacagtgcgtaagttcggcggcagctttgccaca
gtaacgcaaggcatgaacgacttctttgccaacgccgaggccgaagcggcactgaacagt
tcagatattcatatcaccttgcgacaaggtgatggctttggggatttcttgaacaagcat
cctgaccacttctcgcccttcgagcaacacatgatcaagtcattcccccgcgccaatgat
gcgggtcattcctgcgtcatgctcaaagcgggcgggctagtgtcctttcaccgaattttt
gccgatccatggtcgcgcgccatgctctcaaccgagcctaaagaatttgagcattgtgag
aaccttattaaaggcggcatgccgttactcgatgccattgaactgacagcccaacatttc
tatcccgatgatatggcccgttttgatgccattttgtccgcagcagcaacccacaaagag
gccgcataa

DBGET integrated database retrieval system