KEGG   Shewanella baltica OS195: Sbal195_4540
Entry
Sbal195_4540      CDS       T00622                                 
Name
(GenBank) type IV conjugative transfer system protein TraL
  KO
K12068  conjugal transfer pilus assembly protein TraL
Organism
sbn  Shewanella baltica OS195
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbn02044]
    Sbal195_4540
Secretion system [BR:sbn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sbal195_4540
SSDB
Motif
Pfam: TraL DUF3487
Other DBs
NCBI-ProteinID: ABX51697
UniProt: A9L6B5
Position
pS19501:complement(16940..17242)
AA seq 100 aa
MDNPTQFFSIPKHLNNTPTLLGFAMDELVPALVFFAVLFMMNHALIGMVLASSWFLGMRR
MKSQYGMSVLRLTAYWYAPAEFSASFLKRTPAACRRYWLR
NT seq 303 nt   +upstreamnt  +downstreamnt
gtggataaccccactcagttttttagcatccctaaacacctcaacaacacccctacgtta
ttagggtttgcgatggatgaacttgttcctgccttagtgttttttgccgtgttattcatg
atgaatcacgcgctcattggcatggtactagcctcttcatggtttttagggatgcgcaga
atgaaatcgcaatacggcatgagcgtattacgcctcaccgcttattggtacgcccctgca
gaatttagcgcttcatttttaaaacgaacacctgcggcatgtcgccgctactggttacgt
taa

DBGET integrated database retrieval system