KEGG   Shewanella baltica OS195: Sbal195_4625
Entry
Sbal195_4625      CDS       T00622                                 
Name
(GenBank) type-F conjugative transfer system protein TraW
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
sbn  Shewanella baltica OS195
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbn02044]
    Sbal195_4625
Secretion system [BR:sbn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sbal195_4625
SSDB
Motif
Pfam: TraW_N Pedibin
Other DBs
NCBI-ProteinID: ABX51781
UniProt: A9L6A8
Position
pS19502:complement(37758..38462)
AA seq 234 aa
MNKFALLMLALCPLLPLKAASIGTVGQVFPIAEIDMLQWIENRLQTLEKTGELDSMREQF
QENVKAGVKRPRPVGLITTKTPEVFLVDPTLTLAKDINDANGNLIYPKGTRVNPFDTKTW
PALQKANVGKFEFSKTLVFFDGDDVQQVLWAKEFATTHDKPHTIKWILTGGEPETLHGQL
DARVYFDQQGNLSRALTLKRVPSVVKQAGVMWQVREMDVSNFPVFMEETNNAAH
NT seq 705 nt   +upstreamnt  +downstreamnt
atgaataaattcgcgcttctgatgttggcgttatgcccactattaccgctcaaggctgcg
tctatcggcaccgtggggcaagtgttcccgattgctgaaattgacatgctgcagtggatt
gaaaaccgtctgcaaaccttagagaaaacgggtgagctagacagtatgcgcgagcaattc
caagagaatgtcaaagccggtgttaagcgccctcgtccggtggggctcattaccactaaa
acccctgaggtgtttttggtcgatcccaccttaacgctggccaaagatatcaatgatgcg
aatggcaacctgatttatcccaaagggacgcgcgtaaacccatttgacaccaagacatgg
ccagcattgcaaaaggccaacgtcggcaagtttgagttcagtaaaacgctggtgtttttt
gatggggatgatgtgcagcaagtgttatgggccaaagagtttgcaacaacccatgacaag
ccacacaccatcaaatggattttaacgggcggcgaacccgaaacactgcatggccaatta
gatgcgcgcgtttactttgaccagcaaggaaacctcagccgcgccttaacacttaagcgc
gttccaagtgtcgtgaagcaagcgggcgtgatgtggcaagtgcgcgaaatggatgtgtcc
aatttccccgtattcatggaggaaacaaacaatgcggcacattaa

DBGET integrated database retrieval system