KEGG   Shewanella baltica OS195: Sbal195_4692
Entry
Sbal195_4692      CDS       T00622                                 
Name
(GenBank) CagE TrbE VirB component of type IV transporter system
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sbal195_4692
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbn02044]
    Sbal195_4692
Enzymes [BR:sbn01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Sbal195_4692
Secretion system [BR:sbn02044]
 Type IV secretion system
  Trb secretion system protein
   Sbal195_4692
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG DUF87 AAA_23 AAA_22 AAA_29 ABC_tran T2SSE TrwB_AAD_bind FtsK_SpoIIIE RsgA_GTPase MMR_HSR1 ATPase_2 AAA_16 AAA_7
Other DBs
NCBI-ProteinID: ABX51846
UniProt: A9L6R4
Position
pS19503:23179..25605
AA seq 808 aa
MFRTASYRTSIKGMPDLLNYGILCDDGVVANKDGSLMAGFVFRGVDISSSTFGDRNSLAD
SISDLLVSFGTGWMLHVEAVRQKTAEYLNKENSHFSHPMFAAIDEERHDYFSRVAERYES
SYFMFVTYMPPSKAQAQIRDWMFEDSLDKKSLFSKHLDDFQRKLRDISSRLQSYISIRRL
LAYKARNDEGETHYYCELLQKINLMVTGNDRPVRLPFCPVGIDSLIGAHEFWTGMSPKLN
DQYIATIGIDNFPDESSPNILNHLDKLGFAYRWSSRFAFFDLFDAEKALEKERKTWKSRV
ISFKDVLAKTPNPKINEDAAKMVWQYEQALNLARGGKLKYGHYTPAIIVMNESREYLAEC
CEKIVKTIDQLGFGCRVETVNSVETFLGSLPSDSLHNVRRPLVNTVNLGHMLPLSSIWSG
RLTNPCPFYPPNSPAVMQCSAEGAAPFRLNLHIDDLGHFLVFGPTGAGKSTLLATLVAQT
NRYANRKQFVFDKGRAAYPISQCGGTHYDICVDENVTFAPLSHLRTDFAWCCNYIEKLLE
LQNVFISAKQRNGIENGLRELTASNIKDINISDFLHIANDTQITDALNFYTSDSAGNLLN
SRKDSFKSSTLNVFEIGELMKRGTKEMIPVLLYIFRQIERSLDGSPGFIFLDEAWVAFGD
PVFKPMLVEWLKTMRTANCVVGLFTQSLTDAIKSGILDVLIEACPTKIFLANPAADADVI
KPTYKSFGLNDRQIDIIKRAVRKKHYYITSPEGNRLFDLALGELTLAFVGSSSKQHIARI
KTLVGQHQEQWYSHWLVDRGVLNPEDIS
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgtttcgaacagcctcttatcggacatcaattaaagggatgcccgacttattaaattat
ggaattttatgtgacgatggcgtggtagcaaacaaagacggctcattaatggcgggattt
gtttttcgtggagtagatatttcaagttctacatttggtgatcgaaactcactcgccgat
agcatttcagatttattggtgtccttcggtacgggttggatgctccatgttgaggctgtt
cgacaaaaaacagcggaatacttaaataaagaaaattcgcattttagccatcctatgttt
gctgccattgacgaagaacgtcatgactatttctctcgggtcgctgaacgatatgaaagt
tcatatttcatgtttgttacctacatgcccccgtcaaaagcccaggcgcaaatcagagat
tggatgtttgaggattcgctagataaaaaatcgctgttctcaaaacatctcgacgacttc
caacgtaaactccgcgacattagcagccggcttcaatcctatatcagcattcgccggcta
ttggcttataaagcccgtaatgatgagggggaaacccattattactgtgagctattacaa
aaaatcaatctaatggtcacgggtaatgaccgcccagtgagattgccattttgtcccgtg
ggtattgactcgctgattggcgctcatgaattttggacgggaatgagccctaaactaaat
gatcaatacatcgcgaccatcggtatcgataacttccccgatgaaagctctcccaatatt
ttaaatcatcttgataagctcggctttgcttaccggtggtcatcacggtttgcatttttt
gacttatttgatgctgaaaaagcacttgaaaaagaacgtaaaacatggaaatccagagtc
atcagttttaaagacgttcttgcaaaaacgccaaaccctaaaatcaatgaagatgctgca
aaaatggtatggcagtatgaacaagcgttgaacctcgctcggggagggaaattaaagtat
ggccattacacccccgcgattattgtgatgaatgaaagcagggaatacctagccgagtgt
tgcgagaaaattgtcaaaaccattgatcaattagggttcgggtgccgagtagaaacagtg
aacagtgtcgaaacgtttttaggcagtctaccctcagacagtctacacaatgttcgtcgg
ccattggtgaacaccgtcaaccttggccacatgctaccgctgtcatcaatatggtccggc
agattaacaaacccatgtccattttatccccctaattcgccagcggtgatgcaatgtagc
gcagaaggtgcggccccttttcgattaaatctacatatcgatgacttaggccatttcctt
gtgtttggtcctacgggcgcaggtaaatcaacactacttgcgactttggtcgcccaaaca
aaccgttatgccaatcgtaagcaattcgtgtttgataaagggcgagccgcataccccatt
agtcaatgtggaggcactcactacgatatctgtgttgacgaaaatgtgacctttgcgcca
ctgtcacatttgcgaacggactttgcgtggtgttgcaactacatcgaaaaattgctcgaa
ctgcaaaatgttttcatttcagcaaaacagcgcaacggcatagagaacggcctgcgagag
ttaacagcgtccaatattaaagatattaacattagcgattttctacacattgctaacgac
actcaaataactgacgcgcttaatttttataccagtgacagtgcagggaatttacttaat
tcacgaaaggattcatttaaaagttcaaccttaaatgtgtttgaaattggcgaattaatg
aagcggggaacaaaagaaatgatccccgtactactctacatcttccgccaaatagaacga
agcctcgatggttcaccaggatttatctttctcgatgaagcgtgggtagcatttggcgac
cccgtgtttaaaccaatgctcgtcgaatggctaaagaccatgcgaacggctaactgtgtc
gttgggctatttacacaatctcttactgatgcgattaaatccggcattctcgatgtactc
atcgaagcgtgtccgactaaaattttcctcgccaatcctgcagctgacgccgatgtgatt
aaaccaacgtataaaagctttggtttaaatgaccgtcaaatcgacatcattaaacgtgca
gttcgtaagaaacactattacatcacgtcacccgaagggaatcgtttatttgatctcgcg
ctgggtgagctcacccttgcattcgtgggttcaagtagtaaacaacatatcgccaggatt
aaaacgctcgtagggcaacatcaagaacaatggtactcacactggttagttgaccgcggt
gtgctcaatccagaggacattagttaa

DBGET integrated database retrieval system