KEGG   Shewanella baltica OS195: Sbal195_4694
Entry
Sbal195_4694      CDS       T00622                                 

Definition
(GenBank) P-type conjugative transfer protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
sbn  Shewanella baltica OS195
Pathway
sbn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sbal195_4694
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbn02044]
    Sbal195_4694
Secretion system [BR:sbn02044]
 Type IV secretion system
  Trb secretion system protein
   Sbal195_4694
SSDB
Motif
Pfam: TrbL
Other DBs
NCBI-ProteinID: ABX51848
UniProt: A9L6R6
Position
pS19503:26393..27724
AA seq 443 aa
MRLFWLILLLLFIVPNAYAAGVPESGAIDILLETFGNAAAKWAPILRETAIRIFWILVTI
SWTWTFIWMMFKDSNYPEIIAELTRRVVLIGIFSWFLFDGVWIASSIVEGFQYLALKLGG
TPIKPSSIFDIGYSLASSILKKLTYTDWADNIGFILAGLGILIIFAFITLEMMLVTIQYY
IMLNLGVILMGFLGHEWSREYGINYFRLMLSIGVKFMCMQMIIVLSMEILNSWLQTSDLT
WTQILLILPCIIVIWGLVREVPAMAQSLVSGSDTTSGNAMAGAMQAAATTAALTAGAIAL
AAGGGGLLKNAWSQAGGDGGDSGGDGGGGNDPATSPLAENNDGGGGGEANASPLPRSHGN
DNADFQGSISGSEQSPSNANPQGNGSEQAAPKSSLASKFVTTAKIASGALAKEGASSAKK
AFLSSQDTFIGRAASSLAPNKKD
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgcggcttttttggttgatattgctcttactcttcatcgtccctaatgcctacgccgcc
ggtgtcccagaatctggggctatcgacatactgctagaaacctttggaaatgccgccgca
aaatgggcgccgatattacgcgaaaccgccataagaatattttggatattagtcacgata
tcttggacgtggacgtttatctggatgatgttcaaagattcgaactatccagaaattatc
gcggagttaacacggcgagttgttctgattggaatttttagttggttcctatttgatggc
gtgtggatagcatcttcgattgtagaaggcttccaatatctggcattaaagctaggaggt
acgccaataaaaccaagctccatttttgatattggttattcattagcatccagtattctc
aaaaaattaacctatacagattgggcggacaacattggatttattcttgcgggactaggg
atcttaatcatctttgcgttcatcacgctcgaaatgatgttagtcacgattcagtattac
atcatgcttaatttgggggtgattttgatggggttcctcggacacgaatggagccgtgaa
tacggaattaattatttcagattaatgttgtccattggcgttaaatttatgtgtatgcag
atgatcatcgtcttatcaatggaaattttaaacagttggctccaaaccagcgacctaacg
tggacccaaatattgctgattttaccctgtattatcgttatttggggactggtacgagag
gttccagctatggcccagagtctggtgagcggttctgacaccacatcaggtaatgccatg
gctggcgcaatgcaagcagccgcaactaccgcagcactcacggccggagccattgccctt
gccgctggcggaggggggctgctcaagaatgcatggtcacaggctggcggagacggaggg
gacagcggaggtgatggaggcggaggcaatgaccccgcaacgtcaccgttagctgaaaat
aatgatggcggcggtgggggtgaagcaaatgcctcgccactccctcgctcgcacgggaat
gacaacgctgattttcagggttcgatatccggtagtgaacagtctccttcaaatgccaac
cctcaaggcaatggcagtgagcaagcagcgcccaaatcgtccttagcgagcaaatttgtc
acaaccgccaaaatagccagtggcgcgttagcaaaagaaggggccagtagcgctaaaaaa
gcgttcttaagttcacaagacacattcatcggtcgtgctgcaagttcattagcccccaac
aagaaagattaa

DBGET integrated database retrieval system