KEGG   Shigella boydii Sb227 (serotype 4): SBO_0039Help
Entry
SBO_0039          CDS       T00301                                 

Gene name
apaG
Definition
(GenBank) conserved hypothetical protein
  KO
K06195  ApaG protein
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SBO_0039 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ABB64775
ShiBASE_China: SBO0039
UniProt: Q326I3
Position
complement(40291..40668)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRET
EVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDENGVPFSIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtgtgtattcaggttcaaagcgtctacattgaggcacaatct
tcacctgataatgaacgttacgtttttgcttataccgtaaccatacgcaatctggggcga
gcgccagtgcagttgttggggcgttactggctgatcaccaatggcaatggccgtgaaacc
gaagtccagggcgaaggagtggttggcgtccagccacttatcgcgcctggcgaagagtac
cagtacaccagcggtgcaatcattgaaaccccgctgggcaccatgcagggtcactacgaa
atgatcgatgaaaatggcgtccctttcagcatcgacattcccgtattccgactcgccgtt
cccacactcattcattaa

DBGET integrated database retrieval system