KEGG   Shigella boydii Sb227: SBO_0869Help
Entry
SBO_0869          CDS       T00301                                 

Gene name
galF
Definition
(GenBank) probable UDP-gal transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbo  Shigella boydii Sb227
Pathway
sbo00040  Pentose and glucuronate interconversions
sbo00052  Galactose metabolism
sbo00500  Starch and sucrose metabolism
sbo00520  Amino sugar and nucleotide sugar metabolism
sbo01100  Metabolic pathways
sbo01130  Biosynthesis of antibiotics
Module
sbo_M00362  Nucleotide sugar biosynthesis, prokaryotes
sbo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SBO_0869 (galF)
   00052 Galactose metabolism
    SBO_0869 (galF)
   00500 Starch and sucrose metabolism
    SBO_0869 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    SBO_0869 (galF)
Enzymes [BR:sbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SBO_0869 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: ABB65539
ShiBASE_China: SBO0869
UniProt: Q323G9
Position
complement(884041..884934)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELEHTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgagcagcgc
gtgaagcgtcaactgcttgcggaagtgcagtccatctgtccaccgggcgtgaccattatg
aacgtgcgtcagggcgaacctttaggtttgggccactccattttatgtgcacgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctgcgctacaaccttgctgccatgattgcgcgcttcaatgaaacaggacgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactctgtcattcagaccaaa
gaaccgctggatcgcgaaggtaaagtcagtcgcatcgtcgaatttatcgaaaaaccggat
cagccgcagacgctggactcagatatcatggccgtgggccgttatgtgctttctgccgat
atttggccggaacttgaacacactcagcctggtgcatgggggcgtattcagctgactgat
gccattgccgaactggcgaaaaaacagtccgttgatgccatgctgatgactggtgacagc
tacgattgcggtaaaaaaatgggttatatgcaggcgttcgtgaagtatgggctgcgcaac
ctcaaagaaggggcgaagttccgcaaagggattgagaagctgttaagcgaataa

DBGET integrated database retrieval system