KEGG   Shigella boydii Sb227 (serotype 4): SBO_1672Help
Entry
SBO_1672          CDS       T00301                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase, NAD-linked
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00620  Pyruvate metabolism
sbo00630  Glyoxylate and dicarboxylate metabolism
sbo01100  Metabolic pathways
sbo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBO_1672 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    SBO_1672 (aldA)
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     SBO_1672 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     SBO_1672 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-ProteinID: ABB66277
ShiBASE_China: SBO1672
UniProt: Q320I1
Position
complement(1654361..1655644)
Genome map
AA seq 427 aa AA seqDB search
MSVPVQHPMYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEW
EALPAIERASWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWAR
RYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEF
TPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMAT
AAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQ
FVNRLGEAMQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVALGGKAVEG
KGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEEAISMANDSDYGLTSSNLYPKS
ERRDESH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacccgttcaacatcctatgtatatcgatggacagtttgttacctggcgtgga
gacgcatggattgatgtggtaaaccctgctacagaggctgtcatttcccgcatacccgat
ggtcaggccgaggatgcccgtaaggcaatcgatgcagcagaacgtgcacaaccagaatgg
gaagcgttgcctgctattgaacgcgccagttggttgcgcaaaatctccgccgggatccgc
gaacgcgccagtgaaatcagtgcgctgattgttgaagaagggggcaagatccagcagctg
gctgaagtcgaagtggcttttactgccgactatatcgattacatggcggagtgggcacgg
cgttacgagggcgagattattcaaagcgatcgtccaggagaaaatattcttttgtttaaa
cgtgcgcttggtgtgactaccggcattctgccgtggaacttcccgttcttcctcattgcc
cgcaaaatggctcccgctcttttgaccggtaataccatcgtcattaaacctagtgaattt
acgccaaacaatgcgattgcattcgccaaaatcgtcgatgaaataggccttccgcgcggc
gtgtttaaccttgtactggggcgtggtgaaaccgttgggcaagaactggcgggtaaccca
aaggtcgcaatggtcagtatgacaggcagcgtctctgcaggtgagaagatcatggcgact
gcggcgaaaaacatcaccaaagtgtgtctggaattggggggtaaagcaccagctatcgta
atggacgatgccgatcttgaactggcagtcaaagccatcgttgattcacgcgtcattaat
agtgggcaagtgtgtaactgtgcagaacgtgtttatgtacagaaaggcatttatgatcag
ttcgtcaatcggctgggtgaagcgatgcaggcggttcaatttggtaaccccgctgaacgc
aacgacattgcgatggggccgttgattaacgccgcggcgttggaaagggttgagcaaaaa
gtggcgcgcgcagtagaagaaggggcgagagtggcgttgggtggcaaagcggtagagggg
aaaggatattattatccgccgacattgctgctggatgttcgccaggaaatgtcgattatg
catgaggaaacctttggcccggttctgccggtggtcgcatttgacacgctggaagaggct
atctcaatggctaatgacagtgattacggcctgacctcatcaaatctatacccaaaatct
gaacgtcgcgatgaaagccattaa

DBGET integrated database retrieval system